Ccd1/DIXDC1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Ccd1/DIXDC1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ccd1/DIXDC1
  
  

  Source: E.coli

  Amino Acid Sequence: KKQERKVRVKSPRTQVGSEYRESWPPNSKLPHSQSSPTVSSTCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDFKAAIDREGNHRYHFKALD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: DIXDC1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24708It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ccd1/DIXDC1 Recombinant Protein Antigen

• Ccd1
• Coiled-coil protein DIX1
• Coiled-coil-DIX1
• DIX domain containing 1
• DIX domain-containing protein 1
• Dixdc1
• Dixin
• Kiaa1735
• KIAA1735coiled-coil-DIX1

Background

DIXDC1 (DIX domain containing 1/Dixin) is a 683 amino acid protein. It positively regulates the Wnt signaling pathway by activating WNT3A via DVL2. It is expressed ubiquitously but has higher expression in skeletal and cardiac muscle. WNT3A signaling increases DIXDC1 protein levels by inhibiting its ubiquitination and subsequent degradation. DIXDC1 may play a role in breast cancer, breast carcinoma, endometrial cancer, epithelial neoplasia, schizophrenia, colon cancer, and neuroblastoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DIXDC1