We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Ccd1/DIXDC1 Recombinant Protein Antigen

Images

 
There are currently no images for Ccd1/DIXDC1 Recombinant Protein Antigen (NBP2-58141PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Ccd1/DIXDC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to Ccd1/DIXDC1.

Source: E. coli

Amino Acid Sequence: KSESIITQSEEKADFVIIPAEGIENRTEGTDSPLSRDWRPGSPGTYLETSWEEQLLEQQEYLEKEMEEAKKMISGLQALLLNGSLPEDEQERPLALCEPGVNP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DIXDC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58141.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ccd1/DIXDC1 Recombinant Protein Antigen

  • Ccd1
  • Coiled-coil protein DIX1
  • Coiled-coil-DIX1
  • DIX domain containing 1
  • DIX domain-containing protein 1
  • Dixdc1
  • Dixin
  • Kiaa1735
  • KIAA1735coiled-coil-DIX1

Background

DIXDC1 (DIX domain containing 1/Dixin) is a 683 amino acid protein. It positively regulates the Wnt signaling pathway by activating WNT3A via DVL2. It is expressed ubiquitously but has higher expression in skeletal and cardiac muscle. WNT3A signaling increases DIXDC1 protein levels by inhibiting its ubiquitination and subsequent degradation. DIXDC1 may play a role in breast cancer, breast carcinoma, endometrial cancer, epithelial neoplasia, schizophrenia, colon cancer, and neuroblastoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3287
Species: Hu, Mu, Rt
Applications: WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP2-24648
Species: Hu, Mu, Pm, Rt
Applications: WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-83693
Species: Hu
Applications: ICC/IF,  IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-81411
Species: Hu
Applications: IHC,  IHC-P
NBP3-02962
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-35705
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB100-56458
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: WB
NBP2-46367
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
5036-WN
Species: Hu
Applications: BA, BA
NBP2-38866
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP1-83153
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
5036-WN
Species: Hu
Applications: BA, BA
NBP1-90242
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-58141PEP
Species: Hu
Applications: AC

Publications for Ccd1/DIXDC1 Recombinant Protein Antigen (NBP2-58141PEP) (0)

There are no publications for Ccd1/DIXDC1 Recombinant Protein Antigen (NBP2-58141PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ccd1/DIXDC1 Recombinant Protein Antigen (NBP2-58141PEP) (0)

There are no reviews for Ccd1/DIXDC1 Recombinant Protein Antigen (NBP2-58141PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ccd1/DIXDC1 Recombinant Protein Antigen (NBP2-58141PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ccd1/DIXDC1 Products

Research Areas for Ccd1/DIXDC1 Recombinant Protein Antigen (NBP2-58141PEP)

Find related products by research area.

Blogs on Ccd1/DIXDC1

There are no specific blogs for Ccd1/DIXDC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ccd1/DIXDC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DIXDC1