CBX6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CBX6 Antibody [NBP2-14441] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & mitochondria.
Immunohistochemistry-Paraffin: CBX6 Antibody [NBP2-14441] - Staining of human stomach, lower shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CBX6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQG GSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVID
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CBX6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CBX6 Protein (NBP2-14441PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CBX6 Antibody

  • chromobox homolog 6
  • chromobox protein homolog 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47524
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14899
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-40343
Species: Hu
Applications: WB, IHC-P, IP
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF5827
Species: Hu, Mu
Applications: WB
NBP1-49536
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02619
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-30524
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CBX6 Antibody (NBP2-14441) (0)

There are no publications for CBX6 Antibody (NBP2-14441).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBX6 Antibody (NBP2-14441) (0)

There are no reviews for CBX6 Antibody (NBP2-14441). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CBX6 Antibody (NBP2-14441) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CBX6 Products

Bioinformatics Tool for CBX6 Antibody (NBP2-14441)

Discover related pathways, diseases and genes to CBX6 Antibody (NBP2-14441). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBX6 Antibody (NBP2-14441)

Discover more about diseases related to CBX6 Antibody (NBP2-14441).
 

Pathways for CBX6 Antibody (NBP2-14441)

View related products by pathway.

PTMs for CBX6 Antibody (NBP2-14441)

Learn more about PTMs related to CBX6 Antibody (NBP2-14441).

Blogs on CBX6

There are no specific blogs for CBX6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBX6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CBX6