CBR4 Antibody [DyLight 650]

• Reactivity: Hu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 650

CBR4 Antibody [DyLight 650] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-237 of human CBR4 (NP_116172.2).
  
  Sequence:
  MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CBR4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for CBR4 Antibody [DyLight 650]

• 3-oxoacyl-[acyl-carrier-protein] reductase
• carbonic reductase 4
• carbonyl reductase 4
• carbonyl reductase family member 4
• EC 1.1.1
• EC 1.1.1.-
• EC 1.1.1.100
• FLJ14431
• Quinone reductase CBR4
• SDR45C1
• short chain dehydrogenase/reductase family 45C, member 1

Background

The heteroteramer with HSD17B8 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity. Mayplay a role in biosynthesis of fatty acids in mitochondria. The homotetramer may act as NADPH-dependent quinonereductase. Has broad substrate specificity and reduces 9,10-phenanthrenequinone, 1,4-benzoquinone and various othero-quinones and p-quinones (in vitro)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CBR4