SELH Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SELH Antibody [NBP2-14637] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: SELH Antibody [NBP2-14637] - Staining of human bronchus shows strong nuclear positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SELH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KVNPTKPRRGSFEVTLLRPDGSSAELWTGIKKGPPRKLKFPEPQEVVEEL KKYLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C11orf31
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SELH Protein (NBP2-14637PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SELH Antibody

  • C11orf31 chromosome 11 open reading frame 31
  • C17orf10
  • SELH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3798
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49599
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
NBP2-13293
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24750
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP2-58690
Species: Hu
Applications: ICC/IF
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49599
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
NBP1-71648
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-34098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00051734-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for SELH Antibody (NBP2-14637) (0)

There are no publications for SELH Antibody (NBP2-14637).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SELH Antibody (NBP2-14637) (0)

There are no reviews for SELH Antibody (NBP2-14637). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SELH Antibody (NBP2-14637) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SELH Products

SELH NBP2-14637

Bioinformatics Tool for SELH Antibody (NBP2-14637)

Discover related pathways, diseases and genes to SELH Antibody (NBP2-14637). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SELH Antibody (NBP2-14637)

Discover more about diseases related to SELH Antibody (NBP2-14637).
 

Pathways for SELH Antibody (NBP2-14637)

View related products by pathway.

PTMs for SELH Antibody (NBP2-14637)

Learn more about PTMs related to SELH Antibody (NBP2-14637).

Blogs on SELH

There are no specific blogs for SELH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SELH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C11orf31