Recombinant Human CBF1-interacting corepressor Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CBF1-interacting corepressor Protein Summary

Description
CBF1-interacting corepressor (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: HVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEG
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
CIR1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CBF1-interacting corepressor Protein

  • CBF1 interacting corepressor
  • CBF1-interacting corepressor
  • CIRrecepin
  • corepressor interacting with RBPJ 1
  • corepressor interacting with RBPJ, 1
  • Recepin

Background

CIR - CBF1 interacting corepressor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-01702
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4079
Species: Hu
Applications: WB, ICC
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-88082
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
MAB342
Species: Hu
Applications: WB, Flow, AgAct, CyTOF-ready
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
H00009541-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CBF1-interacting corepressor Partial Recombinant Protein (H00009541-Q01) (0)

There are no publications for CBF1-interacting corepressor Partial Recombinant Protein (H00009541-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBF1-interacting corepressor Partial Recombinant Protein (H00009541-Q01) (0)

There are no reviews for CBF1-interacting corepressor Partial Recombinant Protein (H00009541-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CBF1-interacting corepressor Partial Recombinant Protein (H00009541-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CBF1-interacting corepressor Products

Related Products by Gene

Bioinformatics Tool for CBF1-interacting corepressor Partial Recombinant Protein (H00009541-Q01)

Discover related pathways, diseases and genes to CBF1-interacting corepressor Partial Recombinant Protein (H00009541-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBF1-interacting corepressor Partial Recombinant Protein (H00009541-Q01)

Discover more about diseases related to CBF1-interacting corepressor Partial Recombinant Protein (H00009541-Q01).
 

Pathways for CBF1-interacting corepressor Partial Recombinant Protein (H00009541-Q01)

View related products by pathway.

PTMs for CBF1-interacting corepressor Partial Recombinant Protein (H00009541-Q01)

Learn more about PTMs related to CBF1-interacting corepressor Partial Recombinant Protein (H00009541-Q01).

Blogs on CBF1-interacting corepressor

There are no specific blogs for CBF1-interacting corepressor, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CBF1-interacting corepressor Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CIR1

Customers Who Bought This Also Bought