Caveolin-3 Antibody (1G11)

Images

 
ELISA: Caveolin-3 Antibody (1G11) [H00000859-M03] - Detection limit for recombinant GST tagged CAV3 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Caveolin-3 Antibody (1G11) Summary

Immunogen
CAV3 (NP_001225, 1 a.a. - 83 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVP
Marker
Muscle Specific Caveolae Marker, T-tubule Marker
Specificity
CAV3 - caveolin 3
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CAV3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Caveolin-3 Antibody (1G11)

  • CAV3
  • caveolin 3
  • Caveolin3
  • Caveolin-3
  • LGMD1C
  • LGMD1CMGC126100
  • LQT9
  • LQT9MGC126101
  • M-caveolin
  • MGC126129
  • VIP21
  • VIP-21

Background

This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-15109
Species: Hu
Applications: WB, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
AF3049
Species: Hu
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-27084
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00000859-M03
Species: Hu
Applications: WB, ELISA

Publications for Caveolin-3 Antibody (H00000859-M03) (0)

There are no publications for Caveolin-3 Antibody (H00000859-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caveolin-3 Antibody (H00000859-M03) (0)

There are no reviews for Caveolin-3 Antibody (H00000859-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Caveolin-3 Antibody (H00000859-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Caveolin-3 Products

Bioinformatics Tool for Caveolin-3 Antibody (H00000859-M03)

Discover related pathways, diseases and genes to Caveolin-3 Antibody (H00000859-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Caveolin-3 Antibody (H00000859-M03)

Discover more about diseases related to Caveolin-3 Antibody (H00000859-M03).
 

Pathways for Caveolin-3 Antibody (H00000859-M03)

View related products by pathway.

PTMs for Caveolin-3 Antibody (H00000859-M03)

Learn more about PTMs related to Caveolin-3 Antibody (H00000859-M03).

Blogs on Caveolin-3

There are no specific blogs for Caveolin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Caveolin-3 Antibody (1G11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CAV3
Entrez
OMIM
Uniprot