Cav2.2 Antibody

Images

 
Immunohistochemistry-Paraffin: Cav2.2 Antibody [NBP1-91744] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cav2.2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE
Specificity
Specificity of human Cav2.2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CACNA1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
Control Peptide
Cav2.2 Protein (NBP1-91744PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cav2.2 Antibody

  • BIII
  • Brain calcium channel III
  • CACNL1A5calcium channel, L type, alpha-1 polypeptide
  • CACNN
  • calcium channel alpha12.2 subunit
  • calcium channel, N type
  • calcium channel, voltage-dependent, alpha 1B subunit, N type
  • calcium channel, voltage-dependent, L type, alpha 1B subunit
  • calcium channel, voltage-dependent, N type, alpha 1B subunit
  • Cav2.2 voltage-gated Ca2+ channel
  • Cav2.2
  • L type, alpha-1 polypeptide isoform 5
  • voltage-dependent N-type calcium channel subunit alpha-1B
  • Voltage-gated calcium channel subunit alpha Cav2.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000777-Q01
Species: Hu
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86684
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85448
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-22444
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-31116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00022999-R01
Species: Hu
NBP2-59322
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-90906
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91744
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Cav2.2 Antibody (NBP1-91744) (0)

There are no publications for Cav2.2 Antibody (NBP1-91744).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cav2.2 Antibody (NBP1-91744) (0)

There are no reviews for Cav2.2 Antibody (NBP1-91744). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cav2.2 Antibody (NBP1-91744) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Cav2.2 Antibody (NBP1-91744)

Discover related pathways, diseases and genes to Cav2.2 Antibody (NBP1-91744). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cav2.2 Antibody (NBP1-91744)

Discover more about diseases related to Cav2.2 Antibody (NBP1-91744).
 

Pathways for Cav2.2 Antibody (NBP1-91744)

View related products by pathway.

PTMs for Cav2.2 Antibody (NBP1-91744)

Learn more about PTMs related to Cav2.2 Antibody (NBP1-91744).

Blogs on Cav2.2

There are no specific blogs for Cav2.2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cav2.2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNA1B
Entrez
Uniprot