Cathepsin W Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Cathepsin W Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cathepsin W
  
  

  Source: E.coli

  Amino Acid Sequence: EEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGNIETLWRISFWD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CTSW
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24704It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cathepsin W Recombinant Protein Antigen

• cathepsin W (lymphopain)
• cathepsin W
• EC 3.4.22.-
• lymphopain
• LYPN

Background

The protein encoded by the Cathepsin W gene, a member of the peptidase C1 family, is a cysteine proteinase that may have aspecific function in the mechanism or regulation of T-cell cytolytic activity. The encoded protein is found associatedwith the membrane inside the endoplasmic reticulum of natural killer and cytotoxic T-cells. Expression of this gene isup-regulated by interleukin-2. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTSW