Recombinant Human CAT1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CAT1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 431-492 of Human SLC7A1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKIS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC7A1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CAT1 Protein

  • amino acid transporter, cationic 1
  • ATRC1
  • ATRC1ERR
  • CAT1
  • CAT-1System Y+ basic amino acid transporter
  • Ecotropic retroviral leukemia receptor homolog
  • ecotropic retroviral receptor
  • Ecotropic retrovirus receptor homolog
  • HCAT1
  • high affinity cationic amino acid transporter 1
  • REC1L
  • REC1LCAT1
  • SLC7A1
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 1
  • Solute carrier family 7 member 1

Background

SLC7A1 - solute carrier family 7 (cationic amino acid transporter, y+ system), member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00009815-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-58924
Species: Hu
Applications: ICC/IF
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-78911
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47254
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H6812-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP2-30868
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-36491
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
H00009056-B01P
Species: Hu, Rt
Applications: WB
H00006541-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CAT1 Partial Recombinant Protein (H00006541-Q01) (0)

There are no publications for CAT1 Partial Recombinant Protein (H00006541-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAT1 Partial Recombinant Protein (H00006541-Q01) (0)

There are no reviews for CAT1 Partial Recombinant Protein (H00006541-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CAT1 Partial Recombinant Protein (H00006541-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CAT1 Products

Bioinformatics Tool for CAT1 Partial Recombinant Protein (H00006541-Q01)

Discover related pathways, diseases and genes to CAT1 Partial Recombinant Protein (H00006541-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAT1 Partial Recombinant Protein (H00006541-Q01)

Discover more about diseases related to CAT1 Partial Recombinant Protein (H00006541-Q01).
 

Pathways for CAT1 Partial Recombinant Protein (H00006541-Q01)

View related products by pathway.

PTMs for CAT1 Partial Recombinant Protein (H00006541-Q01)

Learn more about PTMs related to CAT1 Partial Recombinant Protein (H00006541-Q01).

Blogs on CAT1

There are no specific blogs for CAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

iNOS Antibody
NB300-605
CAT1 Antibody
NBP1-90066
eNOS Antibody
NB300-500

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CAT1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A1
Entrez