Caspr1 Antibody - BSA Free

Western Blot: Caspr1 Antibody [NBP1-59251] - Titration: 0.2-1 ug/ml, Positive Control: Human Lung.

• Reactivity: Hu, Gt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Caspr1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CNTNAP1(contactin associated protein 1) The peptide sequence was selected from the N terminal of CNTNAP1. Peptide sequence LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CNTNAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID:31607843).

Reactivity Notes

Goat reactivity reported in scientific literature (PMID: 31607843).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Caspr1 Antibody - BSA Free

• Caspr
• Caspr1
• CASPRcaspr1
• CNTNAP
• CNTNAP1
• contactin associated protein 1
• neurexin 4
• Neurexin IV
• neurexin-4
• NRXN4contactin-associated protein 1
• p190

Background

CNTNAP1 was initially identified as a 190-kD protein associated with the contactin-PTPRZ1 complex. The 1,384-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein,' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain. The architecture of its extracellular domain is similar to that of neurexins, and this protein may be the signaling subunit of contactin, enabling recruitment and activation of intracellular signaling pathways in neurons.The gene product was initially identified as a 190-kD protein associated with the contactin-PTPRZ1 complex. The 1,381-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein,' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain. Northern blot analysis showed that the gene is transcribed predominantly in brain as a transcript of 6.2 kb, with weak expression in several other tissues tested. The architecture of its extracellular domain is similar to that of neurexins, and this protein may be the signaling subunit of contactin, enabling recruitment and activation of intracellular signaling pathways in neurons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Caspr1 Antibody (NBP1-59251)(1)

Publication using NBP1-59251

• Sharma S, Chakravarthy H, Suresh G Adult Goat Retinal Neuronal Culture: Applications in Modeling Hyperglycemia Front Neurosci. 2019-09-16 [PMID: 31607843] (ICC/IF, Goat)

Bioinformatics

• Gene Symbol: CNTNAP1
• Uniprot:
  • P78357(Human)