| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 81-270 of human Caspase-4 (NP_001216.1). Sequence: SDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CASP4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Optimal dilution of this antibody should be experimentally determined. |
| Storage | Store at 4C in the dark. |
| Buffer | 50mM Sodium Borate |
| Preservative | 0.05% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Caspase-4 Antibody (NBP3-35895MFV500)Find related products by research area.
|
|
The NLRP3 Inflammasome: Macrophage Activator & Pathology Driver By Victoria Osinski, PhDWhat is the NLRP3 Inflammasome?With its critical role in innate immunity, the nucleotide-binding oligomerization domain-like receptor family, pyrin domain containing 3 (NLRP3) inflammasome ... Read full blog post. |
|
Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T... Read full blog post. |
|
Caspase-4 - a human protease with roles in inflammation and immunity Caspases are a family of cysteine-aspartic acid proteases that cleave caspase proenzymes as well as other protein substrates. Caspases are well known for their role in apoptosis, but they also play a significant role in other cellular processes inc... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CASP4 |