Casein Antibody - BSA Free

Immunohistochemistry-Paraffin: Casein Antibody [NBP2-55090] - Staining of human breast, cerebral cortex, kidney and liver using Anti-CSN1S1 antibody NBP2-55090 (A) shows similar protein distribution across tissues to independent antibody NBP1-91150 (B).

Immunohistochemistry-Paraffin: Casein Antibody [NBP2-55090] - Staining of human liver.

Immunohistochemistry-Paraffin: Casein Antibody [NBP2-55090] - Staining of human lactating breast shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Casein Antibody [NBP2-55090] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: Casein Antibody [NBP2-55090] - Staining of human kidney.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Casein Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NQLQLQAAHAQEQIRRMNENSHVQVPFQQLNQLAAYPYAVWYYPQIMQYVPFPPFSD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CSN1S1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Casein Recombinant Protein Antigen (NBP2-55090PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Casein Antibody - BSA Free

• alpha
• alpha-S1-casein
• CASA
• casein alpha s1
• MGC149368

Background

Important role in the capacity of milk to transport calcium phosphate.Casoxin D acts as opioid antagonist and has vasorelaxing activity mediated by bradykinin B1 receptors

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Casein Antibody (NBP2-55090)(2)

Publications using NBP2-55090

• Langille E In vivo Screening Reveals Epigenetic Regulation of Mammary Epithelial Lineage Integrity and Tumorigenesis Thesis 2023-01-01
• E Langille, KN Al-Zahrani, Z Ma, M Liang, L Uuskula-Re, R Espin, K Teng, A Malik, H Bergholtz, S El Ghamras, S Afiuni-Zad, R Tsai, S Alvi, A Elia, Y Lu, RH Oh, KJ Kozma, D Trcka, M Narimatsu, JC Liu, T Nguyen, S Barutcu, SK Loganathan, R Bremner, GD Bader, SE Egan, DW Cescon, T Sorlie, JL Wrana, HW Jackson, MD Wilson, AK Witkiewicz, ES Knudsen, MA Pujana, GM Wahl, D Schramek Loss of epigenetic regulation disrupts lineage integrity, induces aberrant alveogenesis and promotes breast cancer Cancer Discovery, 2022-12-02;0(0):. 2022-12-02 [PMID: 36108220]

Bioinformatics

• Gene Symbol: CSN1S1