Recombinant Human Carm1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Carm1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 284-381 of Human CARM1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CARM1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Carm1 Protein

  • Carm1
  • coactivator-associated arginine methyltransferase 1EC 2.1.1.-
  • EC 2.1.1
  • histone-arginine methyltransferase CARM1
  • PRMT4
  • PRMT4EC 2.1.1.125
  • Protein arginine N-methyltransferase 4

Background

CARM1 - coactivator-associated arginine methyltransferase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB100-2251
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-61050
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB100-329
Species: Hu
Applications: WB, IHC, IP, PLA, RIA
NB200-331
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
H00085329-T01
Species: Hu
NB100-56641
Species: Hu, Mu
Applications: WB
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
H00010498-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Carm1 Partial Recombinant Protein (H00010498-Q01) (0)

There are no publications for Carm1 Partial Recombinant Protein (H00010498-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carm1 Partial Recombinant Protein (H00010498-Q01) (0)

There are no reviews for Carm1 Partial Recombinant Protein (H00010498-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carm1 Partial Recombinant Protein (H00010498-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carm1 Products

Bioinformatics Tool for Carm1 Partial Recombinant Protein (H00010498-Q01)

Discover related pathways, diseases and genes to Carm1 Partial Recombinant Protein (H00010498-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carm1 Partial Recombinant Protein (H00010498-Q01)

Discover more about diseases related to Carm1 Partial Recombinant Protein (H00010498-Q01).
 

Pathways for Carm1 Partial Recombinant Protein (H00010498-Q01)

View related products by pathway.

PTMs for Carm1 Partial Recombinant Protein (H00010498-Q01)

Learn more about PTMs related to Carm1 Partial Recombinant Protein (H00010498-Q01).
 

Research Areas for Carm1 Partial Recombinant Protein (H00010498-Q01)

Find related products by research area.

Blogs on Carm1

There are no specific blogs for Carm1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Carm1 Antibody
NB200-342

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Carm1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CARM1
Entrez