Cardiotrophin-1/CT-1 Antibody

Images

 
Western Blot: Cardiotrophin-1/CT-1 Antibody [H00001489-D01P] - Analysis of CTF1 expression in Jurkat.
Western Blot: Cardiotrophin-1/CT-1 Antibody [H00001489-D01P] - Analysis of CTF1 expression in transfected 293T cell line by CTF1 polyclonal antibody.Lane 1: CTF1 transfected lysate(21.20 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cardiotrophin-1/CT-1 Antibody Summary

Immunogen
CTF1 (NP_001321.1, 1 a.a. - 201 a.a.) full-length human protein. MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTF1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cardiotrophin-1/CT-1 Antibody

  • cardiophin 1
  • cardiotrophin 1
  • Cardiotrophin1
  • Cardiotrophin-1
  • CT-1CT1
  • CTF1

Background

The protein encoded by this gene is a secreted cytokine that induces cardiac myocyte hypertrophy in vitro. It has been shown to bind and activate the ILST/gp130 receoptor. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

557-NT/CF
Species: Rt
NBP1-32744
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF-249-NA
Species: Hu
Applications: WB, Neut
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-01134
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00386757-R01
Species: Hu
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP1-85410
Species: Hu
Applications: IHC, IHC-P
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Cardiotrophin-1/CT-1 Antibody (H00001489-D01P) (0)

There are no publications for Cardiotrophin-1/CT-1 Antibody (H00001489-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cardiotrophin-1/CT-1 Antibody (H00001489-D01P) (0)

There are no reviews for Cardiotrophin-1/CT-1 Antibody (H00001489-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cardiotrophin-1/CT-1 Antibody (H00001489-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cardiotrophin-1/CT-1 Products

Bioinformatics Tool for Cardiotrophin-1/CT-1 Antibody (H00001489-D01P)

Discover related pathways, diseases and genes to Cardiotrophin-1/CT-1 Antibody (H00001489-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cardiotrophin-1/CT-1 Antibody (H00001489-D01P)

Discover more about diseases related to Cardiotrophin-1/CT-1 Antibody (H00001489-D01P).
 

Pathways for Cardiotrophin-1/CT-1 Antibody (H00001489-D01P)

View related products by pathway.

PTMs for Cardiotrophin-1/CT-1 Antibody (H00001489-D01P)

Learn more about PTMs related to Cardiotrophin-1/CT-1 Antibody (H00001489-D01P).
 

Research Areas for Cardiotrophin-1/CT-1 Antibody (H00001489-D01P)

Find related products by research area.

Blogs on Cardiotrophin-1/CT-1

There are no specific blogs for Cardiotrophin-1/CT-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cardiotrophin-1/CT-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTF1
Entrez
Uniprot