CARD8 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CARD8. Source: E. coli
Amino Acid Sequence: TLVWDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
CARD8 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47527. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for CARD8 Recombinant Protein Antigen
Background
TUCAN (also known as CARD8 and CARDINAL) is a CARD domain containing protein. TUCAN stands for tumor-up-regulated CARD-containing antagonist of caspase nine. Proteins containing a CARD (caspase-associated recruitment domain) domain are key regulators of cell death, cell survival and cytokine production (reviewed in Damiano and Reed, 2004). CARD domains are found in the N-terminal pro-domains of certain caspases, a family of apoptotic and pro-inflammatory proteases, as well as in a diversity of other proteins including TUCAN. CARD domains are homotypic protein interaction motifs that enable networks of proteins to communicate via CARD-CARD interactions. TUCAN is an anti-apoptotic CARD protein that can protect tumors from cell death stimuli, and is overexpressed in certain forms of cancer. The role of TUCAN in tumor biology remains to be fully elucidated, and there appears to be be various mechanisms by TUCAN can potentially contribute to apoptosis resistance (reviewed in Checinska et al, 2006). For example, TUCAN has been shown to inhibit caspase-9 activation by binding to the CARD region of pro-caspase-9, thereby suppressing the formation of the Apaf-1-caspase-9 apoptotic complex and apoptosis. Additionally, a TUCAN isoform has been described that blocks both caspase-8 and caspase-9 mediated apoptosis. However, in some tumors, TUCAN does not appear to interact with caspase-9 and may play a role in modulating NF-kB transcription factor survivial signaling pathways. In this regard a CARD-independent interaction of TUCAN with Ikkg has been described, resulting in the inhibition of interleukin-1 and TNF-induced NF-kB activation. Human TUCAN is a 431 amino acid protein according to GenBank no. gi|14424229|sp|Q9Y2G2|CARD8_HUMAN, and migrates at ~45-49 kDa on SDS-PAGE.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: WB
Publications for CARD8 Protein (NBP2-47527PEP) (0)
There are no publications for CARD8 Protein (NBP2-47527PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CARD8 Protein (NBP2-47527PEP) (0)
There are no reviews for CARD8 Protein (NBP2-47527PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for CARD8 Protein (NBP2-47527PEP) (0)
Additional CARD8 Products
Research Areas for CARD8 Protein (NBP2-47527PEP)
Find related products by research area.
|
Blogs on CARD8