Recombinant Human CARD8 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CARD8 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 322-431 of Human CARD8

Source: Wheat Germ

Amino Acid Sequence: WDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLALDVLFRSISERDPYLVSYLRQQNL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CARD8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CARD8 Protein

  • Apoptotic protein NDPP1
  • CARD inhibitor of NF-kappaB-activating ligands
  • CARDINALFLJ18121
  • CARD-inhibitor of NF-kappa-B-activating ligand
  • caspase recruitment domain family, member 8
  • caspase recruitment domain-containing protein 8
  • DACAR
  • DAKAR
  • KIAA0955DKFZp779L0366
  • NDPP
  • NDPP1MGC57162
  • TUCANFLJ18119
  • Tumor up-regulated CARD-containing antagonist of CASP9
  • tumor up-regulated CARD-containing antagonist of caspase nine

Background

CARD8 - caspase recruitment domain family, member 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54899
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-56152
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-76960
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-84978
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-15554
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88543
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
H00022900-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for CARD8 Partial Recombinant Protein (H00022900-Q01) (0)

There are no publications for CARD8 Partial Recombinant Protein (H00022900-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CARD8 Partial Recombinant Protein (H00022900-Q01) (0)

There are no reviews for CARD8 Partial Recombinant Protein (H00022900-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CARD8 Partial Recombinant Protein (H00022900-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CARD8 Products

Bioinformatics Tool for CARD8 Partial Recombinant Protein (H00022900-Q01)

Discover related pathways, diseases and genes to CARD8 Partial Recombinant Protein (H00022900-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CARD8 Partial Recombinant Protein (H00022900-Q01)

Discover more about diseases related to CARD8 Partial Recombinant Protein (H00022900-Q01).
 

Pathways for CARD8 Partial Recombinant Protein (H00022900-Q01)

View related products by pathway.

PTMs for CARD8 Partial Recombinant Protein (H00022900-Q01)

Learn more about PTMs related to CARD8 Partial Recombinant Protein (H00022900-Q01).
 

Research Areas for CARD8 Partial Recombinant Protein (H00022900-Q01)

Find related products by research area.

Blogs on CARD8

There are no specific blogs for CARD8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CARD8 Antibody
NB100-56181

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CARD8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CARD8