Carboxylesterase 2/CES2 Antibody (4E3) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
CES2 (NP_003860, 514 a.a. ~ 621 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHT |
| Specificity |
CES2 - carboxylesterase 2 (intestine, liver) (4E3) |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
CES2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Carboxylesterase 2/CES2 Antibody (4E3) - Azide and BSA Free
Background
Carboxylesterase 2 is a member of a large multigene family. The enzymes encoded by these genes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: WB, ELISA
Publications for Carboxylesterase 2/CES2 Antibody (H00008824-M03) (0)
There are no publications for Carboxylesterase 2/CES2 Antibody (H00008824-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Carboxylesterase 2/CES2 Antibody (H00008824-M03) (0)
There are no reviews for Carboxylesterase 2/CES2 Antibody (H00008824-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Carboxylesterase 2/CES2 Antibody (H00008824-M03) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Carboxylesterase 2/CES2 Products
Research Areas for Carboxylesterase 2/CES2 Antibody (H00008824-M03)
Find related products by research area.
|
Blogs on Carboxylesterase 2/CES2