Carbonic Anhydrase XIV/CA14 Antibody

Western Blot: Carbonic Anhydrase XIV/CA14 Antibody [H00023632-B01P] - Analysis of CA14 expression in human liver.

Western Blot: Carbonic Anhydrase XIV/CA14 Antibody [H00023632-B01P] - CA14 MaxPab polyclonal antibody. Western Blot analysis of CA14 expression in HepG2.

Western Blot: Carbonic Anhydrase XIV/CA14 Antibody [H00023632-B01P] - Analysis of CA14 expression in K-562.

Western Blot: Carbonic Anhydrase XIV/CA14 Antibody [H00023632-B01P] - Analysis of CA14 expression in transfected 293T cell line by CA14 polyclonal antibody. Lane 1: CA14 transfected lysate(37.07 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

Carbonic Anhydrase XIV/CA14 Antibody Summary

• Immunogen: CA14 (NP_036245.1, 1 a.a. - 337 a.a.) full-length human protein. MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
• Specificity: CA14 - carbonic anhydrase XIV,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CA14
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Carbonic Anhydrase XIV/CA14 Antibody

• CA14
• Carbonate dehydratase XIV
• Carbonic Anhydrase XIV
• carbonic anhydrase XIVcarbonic anhydrase 14
• carbonic dehydratase
• CAXiV
• CA-XIV
• EC 4.2.1.1

Background

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA XIV is predicted to be a type I membrane protein and shares highest sequence similarity with the other transmembrane CA isoform, CA XII; however, they have different patterns of tissue-specific expression and thus may play different physiologic roles. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Carbonic Anhydrase XIV/CA14 Antibody (H00023632-B01P)(1)

Publication using H00023632-B01P

• McGinley C, Bishop DJ. Rest interval duration does not influence adaptations in acid/base transport proteins following 10 weeks of sprint-interval training in active women. Am J Physiol Regul Integr Comp Physiol 2017-02-01 [PMID: 28148492]

Bioinformatics

• Gene Symbol: CA14
• Entrez:
  • 23632(Human)
• Uniprot:
  • NP_036245.1(Human)