Carbonic Anhydrase VII/CA7 Antibody (3B7)

Images

 
Western Blot: Carbonic Anhydrase VII/CA7 Antibody (3B7) [H00000766-M06] - Analysis of CA7 expression in Hela S3 NE (Cat # L013V3).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3B7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Carbonic Anhydrase VII/CA7 Antibody (3B7) Summary

Immunogen
CA7 (NP_005173, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVH*
Specificity
CA7 - carbonic anhydrase VII
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CA7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Carbonic Anhydrase VII/CA7 Antibody (3B7)

  • CA7
  • Carbonate dehydratase VII
  • carbonic anhydrase 7
  • Carbonic Anhydrase VII
  • carbonic anhydrase VIICAVII
  • carbonic dehydratase VII
  • CA-VII
  • EC 4.2.1.1

Background

Carbonic anhydrases are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. The cytosolic protein encoded by this gene is predominantly expressed in the salivary glands. Alternative splicing in the coding region results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87537
Species: Hu
Applications: IHC, IHC-P, WB
NB600-919
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr, IHC-P, WB
H00000761-M02
Species: Hu, Mu
Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
AF2187
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP3-07211
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
796-IC
Species: Mu
Applications: BA
NB500-328
Species: Hu
Applications: CyTOF-ready, Flow, IP
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-50028
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
NB100-417
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, PLA, Simple Western, WB
MAB1936
Species: Hu
Applications: IP, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
DPSG10
Species: Hu
Applications: ELISA

Publications for Carbonic Anhydrase VII/CA7 Antibody (H00000766-M06) (0)

There are no publications for Carbonic Anhydrase VII/CA7 Antibody (H00000766-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase VII/CA7 Antibody (H00000766-M06) (0)

There are no reviews for Carbonic Anhydrase VII/CA7 Antibody (H00000766-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase VII/CA7 Antibody (H00000766-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carbonic Anhydrase VII/CA7 Products

Bioinformatics Tool for Carbonic Anhydrase VII/CA7 Antibody (H00000766-M06)

Discover related pathways, diseases and genes to Carbonic Anhydrase VII/CA7 Antibody (H00000766-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase VII/CA7 Antibody (H00000766-M06)

Discover more about diseases related to Carbonic Anhydrase VII/CA7 Antibody (H00000766-M06).
 

Pathways for Carbonic Anhydrase VII/CA7 Antibody (H00000766-M06)

View related products by pathway.

Research Areas for Carbonic Anhydrase VII/CA7 Antibody (H00000766-M06)

Find related products by research area.

Blogs on Carbonic Anhydrase VII/CA7

There are no specific blogs for Carbonic Anhydrase VII/CA7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbonic Anhydrase VII/CA7 Antibody (3B7) and receive a gift card or discount.

Bioinformatics

Gene Symbol CA7
Entrez
OMIM
Uniprot