Carbonic Anhydrase VII/CA7 Antibody (3B7) - Azide and BSA Free

Western Blot: Carbonic Anhydrase VII/CA7 Antibody (3B7) [H00000766-M06] - Analysis of CA7 expression in Hela S3 NE (Cat # L013V3).

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3B7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Carbonic Anhydrase VII/CA7 Antibody (3B7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CA7 (NP_005173, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVH*
• Specificity: CA7 - carbonic anhydrase VII
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CA7
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Carbonic Anhydrase VII/CA7 Antibody (3B7) - Azide and BSA Free

• CA7
• Carbonate dehydratase VII
• carbonic anhydrase 7
• Carbonic Anhydrase VII
• carbonic anhydrase VIICAVII
• carbonic dehydratase VII
• CA-VII
• EC 4.2.1.1

Background

Carbonic anhydrases are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. The cytosolic protein encoded by this gene is predominantly expressed in the salivary glands. Alternative splicing in the coding region results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CA7
• Entrez:
  • 766(Human)
• OMIM:
  • 114770(Human)
• Uniprot:
  • NP_005173()