Carbonic Anhydrase VI Antibody

Images

 
Western Blot: Carbonic Anhydrase VI Antibody [H00000765-B01P] - Analysis of CA6 expression in transfected 293T cell line by CA6 polyclonal antibody. Lane 1: CA6 transfected lysate(33.88 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Carbonic Anhydrase VI Antibody Summary

Immunogen
CA6 (NP_001206.2, 1 a.a. - 308 a.a.) full-length human protein. MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN
Specificity
CA6 - carbonic anhydrase VI,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CA6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Carbonic Anhydrase VI Antibody

  • CA6
  • Carbonate dehydratase VI
  • carbonic anhydrase 6
  • Carbonic Anhydrase VI
  • carbonic anhydrase VIGUSTIN
  • CA-VI
  • EC 4.2.1.1
  • Gustin
  • MGC21256
  • Salivary carbonic anhydrase
  • Secreted carbonic anhydrase

Background

The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
MAB2186
Species: Hu
Applications: WB, IHC, IP
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-37493
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF1936
Species: Hu
Applications: WB, IP
AF4274
Species: Mu
Applications: WB, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
3177-CA
Species: Hu
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-83396
Species: Hu
Applications: IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-62322
Species: Hu
Applications: WB
AF3865
Species: Hu
Applications: WB, IHC
MAB25031
Species: Hu
Applications: WB, IHC, IP
H00000765-B01P
Species: Hu
Applications: WB

Publications for Carbonic Anhydrase VI Antibody (H00000765-B01P) (0)

There are no publications for Carbonic Anhydrase VI Antibody (H00000765-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase VI Antibody (H00000765-B01P) (0)

There are no reviews for Carbonic Anhydrase VI Antibody (H00000765-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase VI Antibody (H00000765-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carbonic Anhydrase VI Products

Bioinformatics Tool for Carbonic Anhydrase VI Antibody (H00000765-B01P)

Discover related pathways, diseases and genes to Carbonic Anhydrase VI Antibody (H00000765-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase VI Antibody (H00000765-B01P)

Discover more about diseases related to Carbonic Anhydrase VI Antibody (H00000765-B01P).
 

Pathways for Carbonic Anhydrase VI Antibody (H00000765-B01P)

View related products by pathway.

PTMs for Carbonic Anhydrase VI Antibody (H00000765-B01P)

Learn more about PTMs related to Carbonic Anhydrase VI Antibody (H00000765-B01P).
 

Research Areas for Carbonic Anhydrase VI Antibody (H00000765-B01P)

Find related products by research area.

Blogs on Carbonic Anhydrase VI.

CHOP/GADD153 - A regulator and marker for ER-stress induced apoptosis
C/EBP homologous protein (CHOP) is a transcription factor that regulates apoptosis in response to cellular stress. CHOP also known as growth arrest and DNA damage 153 (GADD153) was first cloned because of its induction in response to genotoxic str...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbonic Anhydrase VI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CA6
Entrez
Uniprot