![Western Blot: Carbonic Anhydrase VI Antibody [H00000765-B01P] - Analysis of CA6 expression in transfected 293T cell line by CA6 polyclonal antibody. Lane 1: CA6 transfected lysate(33.88 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-VI-Antibody-Western-Blot-H00000765-B01P-img0002.jpg "Western Blot: Carbonic Anhydrase VI Antibody [H00000765-B01P] - Analysis of CA6 expression in transfected 293T cell line by CA6 polyclonal antibody. Lane 1: CA6 transfected lysate(33.88 KDa). Lane 2: Non-transfected lysate.")
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | CA6 (NP_001206.2, 1 a.a. - 308 a.a.) full-length human protein. MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN |
| Specificity | CA6 - carbonic anhydrase VI, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | CA6 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Carbonic Anhydrase VI Antibody (H00000765-B01P)Find related products by research area.
|
|
CHOP/GADD153 - A regulator and marker for ER-stress induced apoptosis C/EBP homologous protein (CHOP) is a transcription factor that regulates apoptosis in response to cellular stress. CHOP also known as growth arrest and DNA damage 153 (GADD153) was first cloned because of its induction in response to genotoxic str... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CA6 |
| Entrez |
|
| Uniprot |
|
![Western Blot Carbonic Anhydrase IV/CA4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_IV_AF2414_Western_Blot_17231.jpg)
![Immunohistochemistry Carbonic Anhydrase IV/CA4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_IV_AF2414_Immunohistochemistry_17340.jpg)
![Simple Western Carbonic Anhydrase IV/CA4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_IV_AF2414_Simple_Western_18658.jpg)
![Immunohistochemistry Tenascin R Antibody (619) [Unconjugated]](https://images.novusbio.com/images2/Tenascin_R_MAB1624_Immunohistochemistry_10138.jpg)
![Western Blot Tenascin R Antibody (619) [Unconjugated]](https://images.novusbio.com/images/mab1624_mouse-rat-tenascin-r-mab-clone-619-western-blot-35202385637..jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)