Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - Hela cell lysate, concentration 0.2-1 ug/ml.

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - MCF7, Antibody Dilution: 1.0 ug/ml CHST15 is supported by BioGPS gene expression data to be expressed in MCF7.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GALNAC4S-6ST(B cell RAG associated protein) The peptide sequence was selected from the middle region of GALNAC4S-6ST. Peptide sequence YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHST15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free

• B cell RAG associated protein (GALNAC4S-6ST)
• B-cell RAG-associated gene protein
• BRAG
• BRAGKIAA0598RP11-47G11.1
• carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15
• Carbohydrate Sulfotransferase 15
• CHST15
• DKFZp781H1369
• EC 2.8.2.33
• GALNAC4S6ST
• GalNAc4S-6ST
• hBRAG
• MGC34346
• N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase

Background

GALNAC4S-6ST is a sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. GALNAC4S-6ST may also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAG expression; however such results are unclear in vivo.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHST15
• Uniprot:
  • Q7LFX5()