CapG Antibody (6D6)

Images

 
Western Blot: CapG Antibody (6D6) [H00000822-M02] - CAPG monoclonal antibody (M02), clone 6D6 Analysis of CAPG expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: CapG Antibody (6D6) [H00000822-M02] - Analysis of monoclonal antibody to CAPG on HeLa cell. Antibody concentration 30 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
6D6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CapG Antibody (6D6) Summary

Immunogen
CAPG (NP_001738 249 a.a. - 348 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AALYKVSDATGQMNLTKVADSSPFALELLISDDCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYAPNTQVEILPQGHESPIFKQFFKDWK
Specificity
CAPG (6D6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CAPG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CapG Antibody (6D6)

  • actin-regulatory protein CAP-G
  • AFCP
  • CapG
  • capping protein (actin filament), gelsolin-like
  • gelsolin-like capping protein
  • macrophage capping protein
  • macrophage-capping protein
  • MCPActin regulatory protein CAP-G

Background

This gene encodes a member of the gelsolin/villin family of actin-regulatory proteins. The encoded protein reversibly blocks the barbed ends of F-actin filaments in a Ca2+ and phosphoinositide-regulated manner, but does not sever preformed actin filaments. By capping the barbed ends of actin filaments, the encoded protein contributes to the control of actin-based motility in non-muscle cells. Alternatively spliced transcript variants have been observed, but have not been fully described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF2009
Species: Hu
Applications: WB, IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB500-330
Species: Hu
Applications: B/N, Flow, IHC, IHC-P, IP, CyTOF-ready
NB600-1397
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-58661
Species: Hu
Applications: IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
H00000822-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for CapG Antibody (H00000822-M02) (0)

There are no publications for CapG Antibody (H00000822-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CapG Antibody (H00000822-M02) (0)

There are no reviews for CapG Antibody (H00000822-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CapG Antibody (H00000822-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CapG Products

Bioinformatics Tool for CapG Antibody (H00000822-M02)

Discover related pathways, diseases and genes to CapG Antibody (H00000822-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CapG Antibody (H00000822-M02)

Discover more about diseases related to CapG Antibody (H00000822-M02).
 

Pathways for CapG Antibody (H00000822-M02)

View related products by pathway.

PTMs for CapG Antibody (H00000822-M02)

Learn more about PTMs related to CapG Antibody (H00000822-M02).
 

Research Areas for CapG Antibody (H00000822-M02)

Find related products by research area.

Blogs on CapG

There are no specific blogs for CapG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CapG Antibody (6D6) and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPG
Entrez
OMIM
Uniprot