Recombinant Human Cannabinoid R1/CB1/CNR1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cannabinoid R1/CB1/CNR1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-472 of Human CNR1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CNR1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cannabinoid R1/CB1/CNR1 Protein

  • CANN6
  • CANN6CB1R
  • Cannabinoid R1
  • cannabinoid receptor 1 (brain)
  • CannabinoidR1
  • CB1
  • CB1A
  • CB1K5
  • CB1R
  • CB-R
  • CB-RCB1cannabinoid receptor 1
  • central cannabinoid receptor
  • CNR
  • CNR1
  • SKR6R

Background

This gene encodes a protein that is one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the family of guanine-nucleotide-binding protein (G-protein) coupled receptors which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-606
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2307
Species: Hu
Applications: WB
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP2-57234
Species: Hu
Applications: ICC/IF
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-12553
Species: Hu
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01) (0)

There are no publications for Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01) (0)

There are no reviews for Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cannabinoid R1/CB1/CNR1 Products

Bioinformatics Tool for Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01)

Discover related pathways, diseases and genes to Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01)

Discover more about diseases related to Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01).
 

Pathways for Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01)

View related products by pathway.

PTMs for Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01)

Learn more about PTMs related to Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01).
 

Research Areas for Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01)

Find related products by research area.

Blogs on Cannabinoid R1/CB1/CNR1

There are no specific blogs for Cannabinoid R1/CB1/CNR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cannabinoid R1/CB1/CNR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CNR1
Entrez