Cancer Antigen 1 Antibody

Images

 
Immunohistochemistry-Paraffin: Cancer Antigen 1 Antibody [NBP1-88736] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cancer Antigen 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DNNIENYSTNALIQPVDTISISSLRQFETVCKFHWVEAFDDEMTEKPEFQSQVYNYAKDNNIKQDSFKEENPMETSVSANTDQLGNEYF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAGE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cancer Antigen 1 Protein (NBP1-88736PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cancer Antigen 1 Antibody

  • bA69L16.7
  • CAGE-1
  • cancer antigen 1
  • Cancer/testis antigen 3CTAG3CT95
  • cancer/testis antigen 95
  • cancer/testis antigen gene 1
  • cancer-associated gene 1 protein
  • CT3
  • FLJ40441

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00386757-R01
Species: Hu
NBP1-85410
Species: Hu
Applications: IHC, IHC-P
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NBP1-60082
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27072
Species: Hu, Am, Bv, Ca, Eq, Op, Pm
Applications: WB, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-85666
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85416
Species: Hu
Applications: IHC, IHC-P
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NB110-40662
Species: Hu, Mu, Rt, Ca
Applications: PEP-ELISA
H00003090-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88736
Species: Hu
Applications: IHC, IHC-P

Publications for Cancer Antigen 1 Antibody (NBP1-88736) (0)

There are no publications for Cancer Antigen 1 Antibody (NBP1-88736).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cancer Antigen 1 Antibody (NBP1-88736) (0)

There are no reviews for Cancer Antigen 1 Antibody (NBP1-88736). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cancer Antigen 1 Antibody (NBP1-88736) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cancer Antigen 1 Products

Bioinformatics Tool for Cancer Antigen 1 Antibody (NBP1-88736)

Discover related pathways, diseases and genes to Cancer Antigen 1 Antibody (NBP1-88736). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cancer Antigen 1 Antibody (NBP1-88736)

Discover more about diseases related to Cancer Antigen 1 Antibody (NBP1-88736).
 

Pathways for Cancer Antigen 1 Antibody (NBP1-88736)

View related products by pathway.

PTMs for Cancer Antigen 1 Antibody (NBP1-88736)

Learn more about PTMs related to Cancer Antigen 1 Antibody (NBP1-88736).

Blogs on Cancer Antigen 1

There are no specific blogs for Cancer Antigen 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cancer Antigen 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAGE1