CAMSAP1L1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SSVHGVSFDISFDKEDSVQRSTPNRGITRSISNEGLTLNNSHVSKHIRKNLSFKPINGEEEAESIEEELNIDSHSDLKSCVPL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CAMSAP2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CAMSAP1L1 Antibody - BSA Free
Background
CAMSAP1L1 (calmodulin-regulated spectrin-associated protein 1-like protein 1) is related to CAMSAP1. Both contain an N-terminal CH (calponin homology domain) which is an actin-binding domain found in cytoskeletal and signal transduction proteins. The CAMSAP1 family of proteins also contains a unique C-terminal CKK (DUF1781) domain which has been found to bind microtubules. The function of CAMSAP1L1 has not been characterized. CAMSAP1L1 is also known as KIAA7078.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IP, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC
Publications for CAMSAP1L1 Antibody (NBP1-82935) (0)
There are no publications for CAMSAP1L1 Antibody (NBP1-82935).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CAMSAP1L1 Antibody (NBP1-82935) (0)
There are no reviews for CAMSAP1L1 Antibody (NBP1-82935).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CAMSAP1L1 Antibody (NBP1-82935) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CAMSAP1L1 Products
Blogs on CAMSAP1L1