CAMP/LL37/FALL39/Cathelicidin Antibody

Images

 
Western Blot: CAMP/LL37/FALL39/Cathelicidin Antibody [H00000820-B02P] - Analysis of CAMP expression in human spleen.
Western Blot: CAMP/LL37/FALL39/Cathelicidin Antibody [H00000820-B02P] - Analysis of CAMP expression in transfected 293T cell line by CAMP polyclonal antibody. Lane 1: CAMP transfected lysate(18.7 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CAMP/LL37/FALL39/Cathelicidin Antibody Summary

Immunogen
CAMP (NP_004336.2, 1 a.a. - 170 a.a.) full-length human protein. MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Specificity
CAMP - cathelicidin antimicrobial peptide,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CAMP
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CAMP/LL37/FALL39/Cathelicidin Antibody

  • 18 kDa cationic antimicrobial protein
  • CAMP
  • CAMP/LL37
  • CAP18
  • CAP18CRAMP
  • cathelicidin antimicrobial peptide
  • CRAMP
  • FALL39
  • FALL-39
  • FALL39CAP-18
  • hCAP-18
  • LL37

Background

Cathelicidins are a family of antimicrobial proteins predominantly found in the peroxidase negative granules of neutrophils. The cathelicidins are synthesized as preproproteins. Within the neutrophils, they are stored in granules as inactive proforms after removal of the signal peptide. The active biologic domains of the cathelicidins generally reside in the C terminus. The C terminal antimicrobial peptides are activated when cleaved from the proforms of the cathelicidins by serine proteases from azurophil granules.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2758
Species: Hu
Applications: WB, IHC
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-56137
Species: Hu
Applications: ICC/IF
NLS1878
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
870-LP/CF
Species: Hu
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
BPI
7468-BP
Species: Hu
NBP1-85495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000820-B02P
Species: Hu
Applications: WB

Publications for CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P) (0)

There are no publications for CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P) (0)

There are no reviews for CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CAMP/LL37/FALL39/Cathelicidin Products

Bioinformatics Tool for CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P)

Discover related pathways, diseases and genes to CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P)

Discover more about diseases related to CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P).
 

Pathways for CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P)

View related products by pathway.

PTMs for CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P)

Learn more about PTMs related to CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P).

Blogs on CAMP/LL37/FALL39/Cathelicidin

There are no specific blogs for CAMP/LL37/FALL39/Cathelicidin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAMP/LL37/FALL39/Cathelicidin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAMP
Entrez