CAMP/LL37/FALL39/Cathelicidin Antibody Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
CAMP (NP_004336.2, 1 a.a. - 170 a.a.) full-length human protein. MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Specificity |
CAMP - cathelicidin antimicrobial peptide, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
CAMP |
| Purity |
Unpurified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
It has been used for WB. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Unpurified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CAMP/LL37/FALL39/Cathelicidin Antibody
Background
Cathelicidins are a family of antimicrobial proteins predominantly found in the peroxidase negative granules of neutrophils. The cathelicidins are synthesized as preproproteins. Within the neutrophils, they are stored in granules as inactive proforms after removal of the signal peptide. The active biologic domains of the cathelicidins generally reside in the C terminus. The C terminal antimicrobial peptides are activated when cleaved from the proforms of the cathelicidins by serine proteases from azurophil granules.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ba, Hu, Mu, Rt
Applications: EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: WB
Publications for CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P) (0)
There are no publications for CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P) (0)
There are no reviews for CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CAMP/LL37/FALL39/Cathelicidin Antibody (H00000820-B02P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CAMP/LL37/FALL39/Cathelicidin Products
Blogs on CAMP/LL37/FALL39/Cathelicidin