CaMKK2 Antibody (4C7)

Images

 
Genetic Strategies: Knockdown Validated: CaMKK2 Antibody (4C7) [H00010645-M02] - Analysis of CaMKK2 in CFBE cells transfected with control siRNA (left) or CaMKK2 siRNA (right). Image from verified customer review.
Western Blot: CaMKK2 Antibody (4C7) [H00010645-M02] - CAMKK2 monoclonal antibody (M02), clone 4C7 Analysis of CAMKK2 expression in HepG2.
Sandwich ELISA: CaMKK2 Antibody (4C7) [H00010645-M02] - Detection limit for recombinant GST tagged CAMKK2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, BvSpecies Glossary
Applications WB, ELISA, S-ELISA, KD
Clone
4C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

CaMKK2 Antibody (4C7) Summary

Immunogen
CAMKK2 (AAH26060, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSP
Specificity
calcium/calmodulin-dependent protein kinase kinase 2, beta
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CAMKK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
  • Knockdown Validated
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Control
CaMKK2 Knockout 293T Cell Lysate
Reviewed Applications
Read 1 Review rated 5
using
H00010645-M02 in the following applications:

Publications
Read Publication using H00010645-M02.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CaMKK2 Antibody (4C7)

  • calcium/calmodulin-dependent protein kinase kinase 2
  • calcium/calmodulin-dependent protein kinase kinase 2, beta
  • Calcium/calmodulin-dependent protein kinase kinase beta
  • CaM-kinase kinase 2
  • CaM-kinase kinase beta
  • CaM-KK 2
  • CAMKK beta protein
  • CaMKK beta
  • CaM-KK beta
  • CAMKK
  • CAMKKBCaMKK 2
  • EC 2.7.11
  • EC 2.7.11.17
  • KIAA0787calcium/calmodulin-dependent protein kinase beta
  • MGC15254

Background

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Seven transcript variants encoding six distinct isoforms have been identified for this gene. Additional splice variants have been described but their full-length nature has not been determined. The identified isoforms exhibit a distinct ability to undergo autophosphorylation and to phosphorylate the downstream kinases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF7899
Species: Hu
Applications: WB, IHC
NBP2-76979
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-42683
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-90364
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for CaMKK2 Antibody (H00010645-M02)(1)

Review for CaMKK2 Antibody (H00010645-M02) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00010645-M02:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot CaMKK2 H00010645-M02
Enlarge
5
reviewed by:
Anonymous
WB Human 07/15/2016
View

Summary

ApplicationWestern Blot
SpeciesHuman
Lot#7005-4C7-00Aa6
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CaMKK2 Antibody (H00010645-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CaMKK2 Products

Bioinformatics Tool for CaMKK2 Antibody (H00010645-M02)

Discover related pathways, diseases and genes to CaMKK2 Antibody (H00010645-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CaMKK2 Antibody (H00010645-M02)

Discover more about diseases related to CaMKK2 Antibody (H00010645-M02).
 

Pathways for CaMKK2 Antibody (H00010645-M02)

View related products by pathway.

PTMs for CaMKK2 Antibody (H00010645-M02)

Learn more about PTMs related to CaMKK2 Antibody (H00010645-M02).
 

Research Areas for CaMKK2 Antibody (H00010645-M02)

Find related products by research area.

Blogs on CaMKK2

There are no specific blogs for CaMKK2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
07/15/2016
Application: WB
Species: Human

Bioinformatics

Gene Symbol CAMKK2
Entrez
Uniprot