Calsyntenin-2 Antibody

Images

 
Immunohistochemistry-Paraffin: Calsyntenin-2 Antibody [NBP1-85705] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry: Calsyntenin-2 Antibody [NBP1-85705] - Staining of human kidney shows strong membranous positivity in cells of tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calsyntenin-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVDSSEMIFKFDGRQGAKVPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLSTN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Calsyntenin-2 Protein (NBP1-85705PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calsyntenin-2 Antibody

  • alcadein gamma
  • Alcadein-gamma
  • alcagamma
  • ALC-GAMMA
  • cadherin-related family member 13
  • calsyntenin 2
  • Calsyntenin2
  • Calsyntenin-2
  • CDHR13
  • CLSTN2
  • CS2
  • CS2alcadein-gamma
  • CSTN2
  • FLJ39113
  • FLJ39499
  • MGC119560

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5346
Species: Hu
Applications: WB
NBP2-15128
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45868
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
AF5244
Species: Hu
Applications: WB, IHC
NBP1-86288
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-92052
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-85705
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Calsyntenin-2 Antibody (NBP1-85705) (0)

There are no publications for Calsyntenin-2 Antibody (NBP1-85705).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calsyntenin-2 Antibody (NBP1-85705) (0)

There are no reviews for Calsyntenin-2 Antibody (NBP1-85705). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Calsyntenin-2 Antibody (NBP1-85705) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calsyntenin-2 Products

Bioinformatics Tool for Calsyntenin-2 Antibody (NBP1-85705)

Discover related pathways, diseases and genes to Calsyntenin-2 Antibody (NBP1-85705). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calsyntenin-2 Antibody (NBP1-85705)

Discover more about diseases related to Calsyntenin-2 Antibody (NBP1-85705).
 

Pathways for Calsyntenin-2 Antibody (NBP1-85705)

View related products by pathway.

Blogs on Calsyntenin-2

There are no specific blogs for Calsyntenin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calsyntenin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLSTN2
Entrez