Calpain 6 Antibody

Images

 
Western Blot: Calpain 6 Antibody [NBP1-88214] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: Calpain 6 Antibody [NBP1-88214] - Staining of human placenta shows distinct cytoplasmic and nuclear/ nucleolar positivity in trophoblastic cells.

Product Details

Summary
Product Discontinued
View other related Calpain 6 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-88214
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Calpain 6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TLDMPKMSCWNLARGYPKVVTQITVHSAEDLEKKYANETVNPYLVIKCGKEEVRSPVQKNTVHAIFDTQAIFYRRTTDIPIIVQVWNSRKFCDQFLGQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAPN6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calpain 6 Antibody

  • calpain 6
  • calpain-6
  • Calpain-like protease X-linked
  • Calpamodulin
  • CalpMCALPM
  • CANPXcalpamodulin
  • CAPNX
  • DJ914P14.1
  • EC 3.4.22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-06797
Species: Hu
NB100-553
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-33443
Species: Hu
Applications: IHC, IHC-P
H00058508-R04
Species: Hu
H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-28875
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3926
Species: Hu, Mu, Rt
Applications: WB
NBP1-83323
Species: Hu
Applications: WB, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF674
Species: Hu
Applications: WB, Simple Western, Neut
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NB100-2369
Species: Hu
Applications: ICC/IF, IHC
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-83220
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-13963
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
NBP1-88214
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Calpain 6 Antibody (NBP1-88214) (0)

There are no publications for Calpain 6 Antibody (NBP1-88214).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calpain 6 Antibody (NBP1-88214) (0)

There are no reviews for Calpain 6 Antibody (NBP1-88214). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calpain 6 Antibody (NBP1-88214) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calpain 6 Products

Bioinformatics Tool for Calpain 6 Antibody (NBP1-88214)

Discover related pathways, diseases and genes to Calpain 6 Antibody (NBP1-88214). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calpain 6 Antibody (NBP1-88214)

Discover more about diseases related to Calpain 6 Antibody (NBP1-88214).
 

Pathways for Calpain 6 Antibody (NBP1-88214)

View related products by pathway.

PTMs for Calpain 6 Antibody (NBP1-88214)

Learn more about PTMs related to Calpain 6 Antibody (NBP1-88214).

Blogs on Calpain 6

There are no specific blogs for Calpain 6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calpain 6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPN6