Calmodulin Antibody [DyLight 650]

Product Discontinued

Calmodulin Antibody [DyLight 650] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Calmodulin (NP_008819.1).
  
  Sequence:
  LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CALM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for Calmodulin Antibody [DyLight 650]

• CALM
• CALM1
• CALM2
• CALM3
• CALML2
• calmodulin 1 (phosphorylase kinase, delta)
• Calmodulin 1
• calmodulin
• CaM
• CAM1
• CAM2
• CAM3
• CAMB
• CAMC
• CAMI
• CAMIII
• CPVT4
• DD132
• PHKDCAM
• phosphorylase kinase, delta subunit

Background

Calmoduin (CaM) is a calcium modulator protein and a transducer of calcium signals (1-2). Upon calcium binding, calmodulin undergoes conformational changes and binds and modulates a diverse array of proteins. Calcium-bound CaM (Ca2+-CaM) can assume a variety of shapes depending on the target (3). Ca2+-CaM binds many kinases, phosphatases, signaling proteins, and structural proteins affecting a wide variety of processes including neurotransmitter release, muscle contraction, metabolism, apoptosis, inflammation, membrane protein organization, and cytoskeleton movement (2, 4-5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Calmodulin Antibody (NBP3-35196C). (Showing 1 - 1 of 1 FAQ).

1. I am looking for an antibody that can bind an engineered calmodulin domain of a fluorescent biosensor. Can you provide me the amino acid sequence that your calmodulin antibodies were raised against so that I can compare them to the sequence I am working with? Can you please provide your sequence identity for this fragment: D Q L T E E Q I A E F K E A F S L F D K D G D G T I T T K E L G T V M R S L G Q N P T E A E L Q D M I N E V D A D G D G T I D F P E F L T M M A R K M W G T D S E E E I R E A F R V F D K D G N G Y I G A A E L R H V M A N L G E R L T D E E V D E M I R V A D I N G D G Q V S Y E E F V Q M M T A K
   • Please see this link to our available calmodulin antibodies. This sequences shares 94% similarity with human calmodulin and does not share 100% similarity with any known calmodulin sequence. Any of our calmodulin antibodies will be predicted to react with this sequence. Any of our polyclonal antibodies will be a good choice and chances are most of the monoclonal antibodies will cross-react as well although, unfortunately, there is no way to predict this with the monoclonals. NBP1-61548 would be my best recommendation for your assay and sequence.

Bioinformatics

• Gene Symbol: CALM1