Calcium-binding-protein-P22 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP3-35602] - Immunofluorescence analysis of L929 cells using Calcium-binding-protein-P22 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: Calcium-binding-protein-P22 Antibody [NBP3-35602] - Western blot analysis of various lysates using Calcium-binding-protein-P22 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.

Immunocytochemistry/ Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP3-35602] - Immunofluorescence analysis of U-2 OS cells using Calcium-binding-protein-P22 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Calcium-binding-protein-P22 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Calcium-binding-protein-P22 Antibody - BSA Free (NBP3-35602) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human Calcium-binding-protein-P22 (NP_009167.1).
  
  Sequence:
  MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Calcium-binding-protein-P22 Antibody - BSA Free

• Calcineurin B homolog
• Calcineurin homologous protein
• calcium binding protein P22
• Calcium-binding protein CHP
• calcium-binding protein p22
• SLC9A1 binding protein
• SLC9A1BP

Background

Calcium-binding-protein-P22 encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHP1