Recombinant Human Calcitonin Protein

Images

 
SDS-Page: Recombinant Human Calcitonin Protein [H00000796-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Calcitonin Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-90 of Human CALCA partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CALCA

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Calcitonin Protein

  • ATP2B2plasma membrane calcium ATPase
  • ATPase, Ca++ transporting, plasma membrane 4
  • DKFZp686G08106
  • DKFZp686M088
  • EC 3.6.3
  • EC 3.6.3.8
  • Matrix-remodeling-associated protein 1
  • matrix-remodelling associated 1
  • MXRA1
  • Plasma membrane calcium ATPase isoform 4
  • Plasma membrane calcium pump isoform 4
  • plasma membrane calcium pump
  • plasma membrane calcium-transporting ATPase 4
  • PMCA4b
  • PMCA4PMCA4x
  • sarcolemmal calcium pump

Background

CALCA - calcitonin/calcitonin-related polypeptide, alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF6108
Species: Hu
Applications: IHC
NLS6731
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
H00000796-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Calcitonin Partial Recombinant Protein (H00000796-Q01) (0)

There are no publications for Calcitonin Partial Recombinant Protein (H00000796-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calcitonin Partial Recombinant Protein (H00000796-Q01) (0)

There are no reviews for Calcitonin Partial Recombinant Protein (H00000796-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calcitonin Partial Recombinant Protein (H00000796-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Calcitonin Products

Bioinformatics Tool for Calcitonin Partial Recombinant Protein (H00000796-Q01)

Discover related pathways, diseases and genes to Calcitonin Partial Recombinant Protein (H00000796-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calcitonin Partial Recombinant Protein (H00000796-Q01)

Discover more about diseases related to Calcitonin Partial Recombinant Protein (H00000796-Q01).
 

Pathways for Calcitonin Partial Recombinant Protein (H00000796-Q01)

View related products by pathway.

PTMs for Calcitonin Partial Recombinant Protein (H00000796-Q01)

Learn more about PTMs related to Calcitonin Partial Recombinant Protein (H00000796-Q01).
 

Research Areas for Calcitonin Partial Recombinant Protein (H00000796-Q01)

Find related products by research area.

Blogs on Calcitonin

There are no specific blogs for Calcitonin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Calcitonin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CALCA