Calcineurin A Antibody

Images

 
Western Blot: Calcineurin A Antibody [NBP1-88218] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: Calcineurin A Antibody [NBP1-88218] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Calcineurin A Antibody [NBP1-88218] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.
Western Blot: Calcineurin A Antibody [NBP1-88218] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calcineurin A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP3CA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Calcineurin A Protein (NBP1-88218PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calcineurin A Antibody

  • calcineurin A alpha
  • Calcineurin A
  • Calmodulin-dependent calcineurin A subunit alpha isoform
  • CALN
  • CALNA
  • CALNAcatalytic subunit, alpha isoform
  • CAM-PRP catalytic subunit
  • CNA
  • CNA1
  • CNA1CALNA1
  • EC 3.1.3.16
  • PP2B
  • PP3CA
  • PPP2B
  • PPP2BCCN1
  • PPP3CA
  • protein phosphatase 2B, catalytic subunit, alpha isoform
  • protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform(calcineurin A alpha)
  • protein phosphatase 3, catalytic subunit, alpha isozyme
  • serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-356
Species: Hu, Rb
Applications: WB, Simple Western, B/N, ICC/IF, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF1348
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-32567
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
27260002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-56060
Species: Hu
Applications: ICC/IF
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
AF1680
Species: Mu
Applications: WB, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88218
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Calcineurin A Antibody (NBP1-88218) (0)

There are no publications for Calcineurin A Antibody (NBP1-88218).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calcineurin A Antibody (NBP1-88218) (0)

There are no reviews for Calcineurin A Antibody (NBP1-88218). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calcineurin A Antibody (NBP1-88218) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calcineurin A Products

Bioinformatics Tool for Calcineurin A Antibody (NBP1-88218)

Discover related pathways, diseases and genes to Calcineurin A Antibody (NBP1-88218). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calcineurin A Antibody (NBP1-88218)

Discover more about diseases related to Calcineurin A Antibody (NBP1-88218).
 

Pathways for Calcineurin A Antibody (NBP1-88218)

View related products by pathway.

PTMs for Calcineurin A Antibody (NBP1-88218)

Learn more about PTMs related to Calcineurin A Antibody (NBP1-88218).
 

Research Areas for Calcineurin A Antibody (NBP1-88218)

Find related products by research area.

Blogs on Calcineurin A.

The role of HIF-1 Alpha signaling in the retina under hypoxic conditions
Hypoxia inducible factor 1 (HIF-1) is a protein that plays an essential role in hypoxia, or low levels of cellular oxygen. HIF-1 is a heterodimeric protein that consists of a constitutively expressed beta subunit and oxygen related alpha subunit. ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calcineurin A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP3CA
Entrez