Cadherin-20 Antibody

Images

 
Immunohistochemistry: Cadherin-20 Antibody [NBP1-85713] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cadherin-20 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PFQDTTTVHISVEDVDEPPVFEPGFYFVEVPEDVAIGTTIQIISAKDPDVTNNSIRYSIDRSSDPGRFFYVDITTGALMTARPLDREEFSWHNITVLAMEMNNPSQVGSVPVTIKV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDH20
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cadherin-20 Protein (NBP1-85713PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cadherin-20 Antibody

  • cadherin 20, type 2
  • Cadherin20
  • Cadherin-20
  • CDH20
  • CDH7L3Cdh7
  • FLJ37047

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00028513-B01P
Species: Hu
Applications: WB, ELISA
NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27372
Species: Hu, Mu, Ma
Applications: WB
NBP2-58593
Species: Hu
Applications: WB, ICC/IF
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-13901
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46340
Species: Hu
Applications: WB, IHC, IF
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
AF2715
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF7669
Species: Hu, Mu, Rt
Applications: WB
NBP1-80939
Species: Hu
Applications: IHC, IHC-P
AF5434
Species: Hu
Applications: WB, ICC
NBP2-04544
Species: Hu
NBL1-14149
Species: Hu
MAB8626
Species: Hu
Applications: Flow, CyTOF-ready
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00005097-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-48527
Species: Hu
Applications: WB, IHC, IHC-P
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-85713
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Cadherin-20 Antibody (NBP1-85713) (0)

There are no publications for Cadherin-20 Antibody (NBP1-85713).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cadherin-20 Antibody (NBP1-85713) (0)

There are no reviews for Cadherin-20 Antibody (NBP1-85713). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cadherin-20 Antibody (NBP1-85713) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cadherin-20 Products

Bioinformatics Tool for Cadherin-20 Antibody (NBP1-85713)

Discover related pathways, diseases and genes to Cadherin-20 Antibody (NBP1-85713). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cadherin-20 Antibody (NBP1-85713)

Discover more about diseases related to Cadherin-20 Antibody (NBP1-85713).
 

Pathways for Cadherin-20 Antibody (NBP1-85713)

View related products by pathway.

Blogs on Cadherin-20

There are no specific blogs for Cadherin-20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cadherin-20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH20
Entrez