Recombinant Human PCDH11Y GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PCDH11Y GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 57-165 of Human PCDH11Y

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDIN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PCDH11Y
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PCDH11Y GST (N-Term) Protein

  • PCDH11
  • PCDH22protocadherin-22
  • PCDH-PC
  • PCDH-Y
  • PCDHYprotocadherin-11 Y-linked
  • protocadherin 11 Y-linked
  • protocadherin 22
  • Protocadherin on the Y chromosome
  • Protocadherin prostate cancer
  • protocadherin Y
  • Protocadherin-11
  • Protocadherin-22
  • protocadherin-PC

Background

PCDH11Y - protocadherin 11 Y-linked

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00027328-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
6510-CA
Species: Hu
Applications: BA
AF7669
Species: Hu, Mu, Rt
Applications: WB
NBP2-61772
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
H00005097-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-46340
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005100-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, S-ELISA, WB
5604-CA
Species: Hu
Applications: BA
MAB8626
Species: Hu
Applications: CyTOF-ready, Flow
H00028513-B01P
Species: Hu
Applications: WB
NBP2-27372
Species: Hu, Ma, Mu
Applications: WB
NBP2-93484
Species: Hu, Mu, Rt
Applications: WB
6774-CA
Species: Hu
Applications: BA
NBP1-90347
Species: Hu
Applications: IHC, IHC-P, WB
188-C8
Species: Hu
Applications: BA
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB110-58870
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00083259-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PCDH11Y Partial Recombinant Protein (H00083259-Q01) (0)

There are no publications for PCDH11Y Partial Recombinant Protein (H00083259-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCDH11Y Partial Recombinant Protein (H00083259-Q01) (0)

There are no reviews for PCDH11Y Partial Recombinant Protein (H00083259-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCDH11Y Partial Recombinant Protein (H00083259-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCDH11Y Products

Array H00083259-Q01

Bioinformatics Tool for PCDH11Y Partial Recombinant Protein (H00083259-Q01)

Discover related pathways, diseases and genes to PCDH11Y Partial Recombinant Protein (H00083259-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCDH11Y Partial Recombinant Protein (H00083259-Q01)

Discover more about diseases related to PCDH11Y Partial Recombinant Protein (H00083259-Q01).
 

Pathways for PCDH11Y Partial Recombinant Protein (H00083259-Q01)

View related products by pathway.

PTMs for PCDH11Y Partial Recombinant Protein (H00083259-Q01)

Learn more about PTMs related to PCDH11Y Partial Recombinant Protein (H00083259-Q01).

Blogs on PCDH11Y

There are no specific blogs for PCDH11Y, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PCDH11Y GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDH11Y