Protocadherin-8 Antibody (6A8) - Azide and BSA Free

Western Blot: Protocadherin-8 Antibody (6A8) [H00005100-M01] - Analysis of PCDH8 expression in transfected 293T cell line by PCDH8 monoclonal antibody (M01), clone 6A8.Lane 1: PCDH8 transfected lysate(113 KDa).Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: Protocadherin-8 Antibody (6A8) [H00005100-M01] - Analysis of monoclonal antibody to PCDH8 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.

Western Blot: Protocadherin-8 Antibody (6A8) [H00005100-M01] - Analysis of PCDH8 over-expressed 293 cell line, cotransfected with PCDH8 Validated Chimera RNAi ( Cat # H00005100-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PCDH8 monoclonal antibody (M01), clone 6A8 (Cat # H00005100-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: Protocadherin-8 Antibody (6A8) [H00005100-M01] - PCDH8 monoclonal antibody (M01), clone 6A8 Analysis of PCDH8 expression in COLO 320 HSR.

Sandwich ELISA: Protocadherin-8 Antibody (6A8) [H00005100-M01] - Detection limit for recombinant GST tagged PCDH8 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC, KD
• Clone: 6A8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Protocadherin-8 Antibody (6A8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PCDH8 (NP_002581, 32 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRYSTFEEDAPGTVIGTLAEDLHMKVSGDTSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH
• Specificity: PCDH8 - protocadherin 8
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PCDH8
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Protocadherin-8 Antibody (6A8) - Azide and BSA Free

• Arcadlin
• PAPC
• PCDH8
• protocadherin 8
• Protocadherin8
• Protocadherin-8

Background

This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The gene encodes an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region. Alternative splicing yields isoforms with unique cytoplasmic tails.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Protocadherin-8 Antibody (H00005100-M01)(4)

Publications using H00005100-M01

• Yosuke I, Toshinori S, Natsumi Y et al. Comparative distribution of Arcadlin/Protocadherin-8 mRNA in the intact and ischemic brains of adult mice. J Comp Neurol. 2022-04-03 [PMID: 35368102]
• Chiaki T, Miho I, Toshinori S et al. Dendritic Spine Density is Increased in Arcadlin-deleted Mouse Hippocampus. Neuroscience. 2020-07-03 [PMID: 32629153]
• Tanaka H, Sawano T, Konishi N et al. Serotonin induces Arcadlin in hippocampal neurons. Neurosci Lett. 2020-01-22 [PMID: 31981722]
• Haeberle H, Dudley JT, Liu JT et al. Identification of Cell Surface Targets through Meta-analysis of Microarray Data. Neoplasia. 2012-07-01 [PMID: 22904683]

Bioinformatics

• Gene Symbol: PCDH8
• Entrez:
  • 5100(Human)
• OMIM:
  • 603580(Human)
• Uniprot:
  • NP_002581(Human)