CACNG1 Antibody

Images

 
Western Blot: CACNG1 Antibody [NBP1-69076] - Titration: 0.2-1 ug/ml, Positive Control: Rat Heart.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CACNG1 Antibody Summary

Immunogen
Synthetic peptides corresponding to Cacng1 (calcium channel, voltage-dependent, gamma subunit 1) The peptide sequence was selected from the middle region of Cacng1. Peptide sequence KNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIIIGSICAFL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CACNG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Cacng1 and was validated on Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CACNG1 Antibody

  • CACNLGDihydropyridine-sensitive L-type, skeletal muscle calcium channel subunit gamma
  • calcium channel, voltage-dependent, gamma subunit 1
  • L-type calcium channel gamma polypeptide
  • neuronal dihydropyridine-sensitive calcium channel gamma subunit
  • voltage-dependent calcium channel gamma-1 subunit

Background

This protein is a subunit of the dihydropyridine (DHP) sensitive calcium channel. Cacng1 plays a role in excitation-contraction coupling. The skeletal muscle DHP-sensitive Ca2+ channel may function only as a multiple subunit complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
NB300-542
Species: Hu, Mu, Rt, GP, Rb
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-14432
Species: Hu
Applications: IHC, IHC-P
NBP2-55863
Species: Hu
Applications: ICC/IF
NBP1-86228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74389
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-12907
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-22411
Species: Rt
Applications: WB, ICC/IF
H00010368-M01
Species: Hu, Rt
Applications: WB, ELISA
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
H00006329-R01
Species: Hu
H00000817-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, RNAi
MAB7555
Species: Hu
Applications: WB, Simple Western
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
MAB38352
Species: Hu, Mu
Applications: WB, ICC
H00008819-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-69076
Species: Rt
Applications: WB

Publications for CACNG1 Antibody (NBP1-69076) (0)

There are no publications for CACNG1 Antibody (NBP1-69076).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNG1 Antibody (NBP1-69076) (0)

There are no reviews for CACNG1 Antibody (NBP1-69076). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CACNG1 Antibody (NBP1-69076) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CACNG1 Products

Bioinformatics Tool for CACNG1 Antibody (NBP1-69076)

Discover related pathways, diseases and genes to CACNG1 Antibody (NBP1-69076). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNG1 Antibody (NBP1-69076)

Discover more about diseases related to CACNG1 Antibody (NBP1-69076).
 

Pathways for CACNG1 Antibody (NBP1-69076)

View related products by pathway.

Blogs on CACNG1

There are no specific blogs for CACNG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CACNG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNG1
Uniprot