CACNB2 Antibody


Immunohistochemistry-Paraffin: CACNB2 Antibody [NBP1-86680] - Staining of human lateral ventricle shows strong positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CACNB2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVI
Specificity of human CACNB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CACNB2 Protein (NBP1-86680PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CACNB2 Antibody

  • CAB2
  • Calcium channel voltage-dependent subunit beta 2
  • calcium channel, voltage-dependent, beta 2 subunit
  • CAVB2
  • FLJ23743
  • Lambert-Eaton myasthenic syndrome antigen B
  • myasthenic (Lambert-Eaton) syndrome antigen B
  • MYSB
  • voltage-dependent L-type calcium channel subunit beta-2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for CACNB2 Antibody (NBP1-86680) (0)

There are no publications for CACNB2 Antibody (NBP1-86680).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNB2 Antibody (NBP1-86680) (0)

There are no reviews for CACNB2 Antibody (NBP1-86680). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CACNB2 Antibody (NBP1-86680) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CACNB2 Products

Bioinformatics Tool for CACNB2 Antibody (NBP1-86680)

Discover related pathways, diseases and genes to CACNB2 Antibody (NBP1-86680). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNB2 Antibody (NBP1-86680)

Discover more about diseases related to CACNB2 Antibody (NBP1-86680).

Pathways for CACNB2 Antibody (NBP1-86680)

View related products by pathway.

PTMs for CACNB2 Antibody (NBP1-86680)

Learn more about PTMs related to CACNB2 Antibody (NBP1-86680).

Blogs on CACNB2

There are no specific blogs for CACNB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CACNB2 Antibody and receive a gift card or discount.


Gene Symbol CACNB2