CACNA2D4 Antibody

Images

 
Western Blot: CACNA2D4 Antibody [NBP2-87111] - Host: Rabbit. Target Name: CACNA2D4. Sample Type: A549 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CACNA2D4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CACNA2D4. Peptide sequence: ADLNHEFNESLVFDYYNSVLINERDEKGNFVELGAEFLLESNAHFSNLPV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CACNA2D4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CACNA2D4 Antibody

  • calcium channel, voltage-dependent, alpha 2/delta subunit 4
  • RCD4
  • voltage-dependent calcium channel subunit alpha-2/delta-4
  • voltage-gated calcium channel alpha(2)delta-4 subunit
  • Voltage-gated calcium channel subunit alpha-2/delta-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-22439
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP2-76961
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-46159
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB300-189
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-82018
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB120-5663
Species: Bv, Ca, Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30557
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-47561
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
AF6989
Species: Mu
Applications: IHC
NBP1-28641
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, PA, WB
NBP2-33296
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20696
Species: Mu
Applications: IHC, IHC-Fr, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for CACNA2D4 Antibody (NBP2-87111) (0)

There are no publications for CACNA2D4 Antibody (NBP2-87111).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNA2D4 Antibody (NBP2-87111) (0)

There are no reviews for CACNA2D4 Antibody (NBP2-87111). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CACNA2D4 Antibody (NBP2-87111) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CACNA2D4 Products

Bioinformatics Tool for CACNA2D4 Antibody (NBP2-87111)

Discover related pathways, diseases and genes to CACNA2D4 Antibody (NBP2-87111). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNA2D4 Antibody (NBP2-87111)

Discover more about diseases related to CACNA2D4 Antibody (NBP2-87111).
 

Pathways for CACNA2D4 Antibody (NBP2-87111)

View related products by pathway.

PTMs for CACNA2D4 Antibody (NBP2-87111)

Learn more about PTMs related to CACNA2D4 Antibody (NBP2-87111).
 

Research Areas for CACNA2D4 Antibody (NBP2-87111)

Find related products by research area.

Blogs on CACNA2D4

There are no specific blogs for CACNA2D4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CACNA2D4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNA2D4