CACNA2D3 Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 900-1040 of human CACNA2D3 (NP_060868.2). LYDYQAMCRANKESSDGAHGLLDPYNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQKLKQTLEPCDTEYPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCESVAPITMAPIEIRYNESLKC |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CACNA2D3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:1000-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CACNA2D3 Antibody - BSA Free
Background
The CACNA2D3 gene encodes a voltage-dependent calcium channel subunit alpha-2/delta-3 protein that exists in three isoforms: isoform 1: 1,091 amino acids long, 123 kDA; isoform 2: 997 amino acids long, 112 kDA; and isoform 3: 519 amino acids long, 59 kDA. These proteins are critical in calcium current density and in activation and inactivation kinetics of the calcium channel. Additionally, these proteins function as regulatory subunits for P/Q-type calcium channel, N-type, and L-type, but not T-type. The CACNA2D3 gene participates in the transcription CREB pathway, Fc-GammaRpathway, PDGF and BMP pathways, as well as the transmission across chemical synapses. It is known to interact with genes PRKACA, PRKACB, PRKACG, YWHAB, and RAD51C. CACNA2D3 is associated with carcinoma, neuronitis, gastric cancer, night blindness, laband syndrome, hypertrichosis, and zimmermann-laband syndrome.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Av, Bv, Sh
Applications: WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ChIP, ICC, WB
Publications for CACNA2D3 Antibody (NBP2-92012) (0)
There are no publications for CACNA2D3 Antibody (NBP2-92012).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CACNA2D3 Antibody (NBP2-92012) (0)
There are no reviews for CACNA2D3 Antibody (NBP2-92012).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CACNA2D3 Antibody (NBP2-92012) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CACNA2D3 Products
Research Areas for CACNA2D3 Antibody (NBP2-92012)
Find related products by research area.
|
Blogs on CACNA2D3