CACNA1G Antibody - BSA Free

Western Blot: CACNA1G Antibody [NBP1-80105] - Host: Rabbit. Target Name: CACNA1G. Sample Tissue: Human 786-0 Whole Cell. Antibody Dilution: 1ug/ml

Immunohistochemistry-Paraffin: CACNA1G Antibody [NBP1-80105] - Human Brain, cortex tissue at an antibody concentration of 2.5ug/ml.

Western Blot: CACNA1G Antibody [NBP1-80105] - Titration: 0.2-1 ug/ml, Positive Control: Human Spleen.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CACNA1G Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CACNA1G. Peptide Sequence VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CACNA1G
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 2.5 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 241 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CACNA1G Antibody - BSA Free

• CACNA1G
• calcium channel, voltage-dependent, T type, alpha 1G subunit
• Cav3.1c
• KIAA1123
• NBR13
• voltage-dependent calcium channel alpha 1G subunit
• voltage-dependent T-type calcium channel subunit alpha-1G
• voltage-dependent, alpha 1G subunit
• voltage-dependent, T type, alpha-1G subunit

Background

Voltage-activated calcium channels can be distinguished based on their voltage-dependence, deactivation, and single-channel conductance. See MIM 601011. Low-voltage-activated calcium channels are referred to as 'T' type because their currents are both transient, owing to fast inactivation, and tiny, owing to small conductance. T-type channels are thought to be involved in pacemaker activity, low-threshold calcium spikes, neuronal oscillations and resonance, and rebound burst firing.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CACNA1G Antibody (NBP1-80105)(1)

Publication using NBP1-80105

• Borahay Ma, Kilic Gs, Yallampalli C et al. Simvastatin Potently Induces Calcium-Dependent Apoptosis of Human Leiomyoma Cells J. Biol. Chem. 2014-10-30 [PMID: 25359773] (WB, Human)
  
  Details:
  CACnA1G / T-CaV (T-type voltage-gated calcium channels) antibody used for WB on lysates of human leiomyoma cell treated or not with Simvastatin (FIGURE 6D).

Bioinformatics

• Gene Symbol: CACNA1G
• Entrez:
  • 8913(Human)
• Uniprot:
  • O43497(Human)