CACNA1A Recombinant Protein Antigen

Images

 
There are currently no images for CACNA1A Recombinant Protein Antigen (NBP3-17155PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CACNA1A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CACNA1A

Source: E. coli

Amino Acid Sequence: APATYEGDARREDKERRHRRRKENQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESAAPHGSLGHAGLPQSPAKMGNRTDP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CACNA1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17155.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CACNA1A Recombinant Protein Antigen

  • APCA
  • BI
  • brain calcium channel 1
  • Brain calcium channel I
  • CACH4
  • CACN3
  • CACNL1A4CAV2.1
  • Calcium channel, L type, alpha-1 polypeptide isoform 4
  • calcium channel, L type, alpha-1 polypeptide
  • calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
  • Cav2.1
  • EA2
  • FHM
  • HPCA
  • MHP
  • MHP1
  • SCA6
  • voltage-dependent P/Q-type calcium channel subunit alpha-1A
  • Voltage-gated calcium channel subunit alpha Cav2.1

Background

FUNCTION: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1A gives rise to P and/or Q-type calcium currents. P/Q-type calcium channels belong to the 'high-voltage activated' (HVA) group and are blocked by the funnel toxin (Ftx) and by the omega-agatoxin-IVA (omega-Aga-IVA). They are however insensitive to dihydropyridines (DHP), and omega-conotoxin-GVIA (omega-CTx-GVIA).; SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein.; Tissue specificity: Brain specific; mainly found in cerebellum, cerebral cortex, thalamus and hypothalamus. No expression in heart, kidney, liver or muscle. Purkinje cells contain predominantly P-type VSCC, the Q-type being a prominent calcium current in cerebellar granule cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PLA, Simple Western, WB
NBP3-25371
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-90063
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP1-51843
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP3-32061
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-92004
Species: Hu, Mu, Rt
Applications: WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB400-144
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-47733
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP3-52190
Species: Hu
Applications: Flow, WB
NB110-68133
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-19491
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
H00051531-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NBP3-17155PEP
Species: Hu
Applications: AC

Publications for CACNA1A Recombinant Protein Antigen (NBP3-17155PEP) (0)

There are no publications for CACNA1A Recombinant Protein Antigen (NBP3-17155PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNA1A Recombinant Protein Antigen (NBP3-17155PEP) (0)

There are no reviews for CACNA1A Recombinant Protein Antigen (NBP3-17155PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CACNA1A Recombinant Protein Antigen (NBP3-17155PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CACNA1A Products

Array NBP3-17155PEP

Research Areas for CACNA1A Recombinant Protein Antigen (NBP3-17155PEP)

Find related products by research area.

Blogs on CACNA1A

There are no specific blogs for CACNA1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CACNA1A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNA1A