CACNA1A Recombinant Protein Antigen

Images

 
There are currently no images for CACNA1A Protein (NBP2-38049PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CACNA1A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CACNA1A.

Source: E.coli

Amino Acid Sequence: KFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGI

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CACNA1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38049.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
using
NBP2-38049PEP in the following application:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CACNA1A Recombinant Protein Antigen

  • APCA
  • BI
  • brain calcium channel 1
  • Brain calcium channel I
  • CACH4
  • CACN3
  • CACNL1A4CAV2.1
  • Calcium channel, L type, alpha-1 polypeptide isoform 4
  • calcium channel, L type, alpha-1 polypeptide
  • calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
  • Cav2.1
  • EA2
  • FHM
  • HPCA
  • MHP
  • MHP1
  • SCA6
  • voltage-dependent P/Q-type calcium channel subunit alpha-1A
  • Voltage-gated calcium channel subunit alpha Cav2.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-104
Species: Hu, Mu, Rt, Po, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-51689
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-42657
Species: Hu
Applications: WB, IP
NBP2-76923
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90044
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91744
Species: Hu
Applications: IHC, IHC-P
H00005347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-58876PEP
Species: Hu
Applications: AC
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83269
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14424
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CACNA1A Protein (NBP2-38049PEP) (0)

There are no publications for CACNA1A Protein (NBP2-38049PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for CACNA1A Protein (NBP2-38049PEP) (1) 51

Average Rating: 5
(Based on 1 review)

Reviews using NBP2-38049PEP:
Filter by Applications
WB
(1)
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot CACNA1A NBP2-38049PEP
Enlarge
reviewed by:
Anonymous
WB 01/23/2018
View

Summary

ApplicationWestern Blot
LotR90137

Comments

CommentsWestern Blot, Cell lysate, ARPE19 cells

FAQs for CACNA1A Protein (NBP2-38049PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional CACNA1A Products

Array NBP2-38049PEP

Bioinformatics Tool for CACNA1A Protein (NBP2-38049PEP)

Discover related pathways, diseases and genes to CACNA1A Protein (NBP2-38049PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNA1A Protein (NBP2-38049PEP)

Discover more about diseases related to CACNA1A Protein (NBP2-38049PEP).
 

Pathways for CACNA1A Protein (NBP2-38049PEP)

View related products by pathway.

PTMs for CACNA1A Protein (NBP2-38049PEP)

Learn more about PTMs related to CACNA1A Protein (NBP2-38049PEP).

Blogs on CACNA1A

There are no specific blogs for CACNA1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SR-BI Antibody
NB400-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
01/23/2018
Application: WB
Species:

Bioinformatics

Gene Symbol CACNA1A