CACNA1A Antibody


Immunocytochemistry/ Immunofluorescence: CACNA1A Antibody [NBP2-38049] - Immunofluorescent staining of human cell line BJ shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: CACNA1A Antibody [NBP2-38049] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CACNA1A Antibody [NBP2-38049] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: CACNA1A Antibody [NBP2-38049] - Staining in human cerebral cortex and pancreas tissues using anti-CACNA1A antibody. Corresponding CACNA1A RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

CACNA1A Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: KFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGI
Specificity of human CACNA1A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CACNA1A Protein (NBP2-38049PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CACNA1A Antibody

  • APCA
  • BI
  • brain calcium channel 1
  • Brain calcium channel I
  • CACH4
  • CACN3
  • CACNL1A4CAV2.1
  • Calcium channel, L type, alpha-1 polypeptide isoform 4
  • calcium channel, L type, alpha-1 polypeptide
  • calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
  • Cav2.1
  • EA2
  • FHM
  • HPCA
  • MHP
  • MHP1
  • SCA6
  • voltage-dependent P/Q-type calcium channel subunit alpha-1A
  • Voltage-gated calcium channel subunit alpha Cav2.1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Hu
Applications: IP (-), WB
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CACNA1A Antibody (NBP2-38049) (0)

There are no publications for CACNA1A Antibody (NBP2-38049).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNA1A Antibody (NBP2-38049) (0)

There are no reviews for CACNA1A Antibody (NBP2-38049). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CACNA1A Antibody (NBP2-38049) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CACNA1A Antibody (NBP2-38049)

Discover related pathways, diseases and genes to CACNA1A Antibody (NBP2-38049). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNA1A Antibody (NBP2-38049)

Discover more about diseases related to CACNA1A Antibody (NBP2-38049).

Pathways for CACNA1A Antibody (NBP2-38049)

View related products by pathway.

PTMs for CACNA1A Antibody (NBP2-38049)

Learn more about PTMs related to CACNA1A Antibody (NBP2-38049).

Blogs on CACNA1A

There are no specific blogs for CACNA1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CACNA1A Antibody and receive a gift card or discount.


Gene Symbol CACNA1A