CABC1 Antibody

Images

 
Western Blot: CABC1 Antibody [NBP1-54749] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CABC1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CABC1(chaperone, ABC1 activity of bc1 complex homolog (S. pombe)) The peptide sequence was selected from the N terminal of CABC1. Peptide sequence FANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEKARQAKARPENKQHKQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADCK3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CABC1 and was validated on Western blot.
Theoretical MW
72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CABC1 Antibody

  • aarF domain containing kinase 3
  • chaperone, ABC1 activity of bc1 complex homolog (S. pombe)
  • chaperone, ABC1 activity of bc1 complex homolog
  • chaperone, ABC1 activity of bc1 complex like (S. pombe)
  • chaperone-ABC1 (activity of bc1 complex, S.pombe)-like
  • Chaperone-ABC1-like
  • coenzyme Q8 homolog
  • EC 2.7.11
  • EC 2.7.11.-
  • MGC4849
  • mitochondrial
  • SCAR9

Background

CABC1 is a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis.This gene encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis. Alternatively spliced transcript variants have been found; however, their full-length nature has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP1-85511
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-88450
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56780
Species: Hu
Applications: WB, ICC/IF
NBP2-01512
Species: Hu, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-83950
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-39084
Species: Hu
Applications: IHC, IHC-P
NBP2-13860
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000141-M04
Species: Hu
Applications: WB, ELISA, IHC-P
H00026119-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-55409
Species: Hu
Applications: WB, ICC/IF
NB100-534
Species: Hu
Applications: WB, IP
NBP2-58572
Species: Hu
Applications: ICC/IF, IHC-P
H00000817-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-13859
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-54749
Species: Hu
Applications: WB

Publications for CABC1 Antibody (NBP1-54749) (0)

There are no publications for CABC1 Antibody (NBP1-54749).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CABC1 Antibody (NBP1-54749) (0)

There are no reviews for CABC1 Antibody (NBP1-54749). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CABC1 Antibody (NBP1-54749) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CABC1 Products

Bioinformatics Tool for CABC1 Antibody (NBP1-54749)

Discover related pathways, diseases and genes to CABC1 Antibody (NBP1-54749). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CABC1 Antibody (NBP1-54749)

Discover more about diseases related to CABC1 Antibody (NBP1-54749).
 

Pathways for CABC1 Antibody (NBP1-54749)

View related products by pathway.

PTMs for CABC1 Antibody (NBP1-54749)

Learn more about PTMs related to CABC1 Antibody (NBP1-54749).
 

Research Areas for CABC1 Antibody (NBP1-54749)

Find related products by research area.

Blogs on CABC1

There are no specific blogs for CABC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CABC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADCK3
Uniprot