CAB39L Antibody

Images

 
Western Blot: CAB39L Antibody [NBP1-74079] - COLO205 Cell Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CAB39L Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of CAB39L. Immunizing peptide sequence EILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAB39L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CAB39L and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CAB39L Antibody

  • Antigen MLAA-34
  • bA103J18.3
  • calcium binding protein 39-like
  • calcium-binding protein 39-like
  • FLJ12577
  • MO25-BETA
  • Mo25-like protein
  • MO2L
  • RP11-103J18.3
  • sarcoma antigen NY-SAR-79
  • U937-associated antigen

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-15658
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-17349
Species: Hu
AF3848
Species: Hu
Applications: WB, IHC, IP
NBP2-14197
Species: Hu
Applications: IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00010146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi SP
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-32390
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-23670
Species: Hu
Applications: WB, Simple Western
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA

Publications for CAB39L Antibody (NBP1-74079) (0)

There are no publications for CAB39L Antibody (NBP1-74079).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAB39L Antibody (NBP1-74079) (0)

There are no reviews for CAB39L Antibody (NBP1-74079). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CAB39L Antibody (NBP1-74079) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CAB39L Products

Bioinformatics Tool for CAB39L Antibody (NBP1-74079)

Discover related pathways, diseases and genes to CAB39L Antibody (NBP1-74079). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAB39L Antibody (NBP1-74079)

Discover more about diseases related to CAB39L Antibody (NBP1-74079).
 

Pathways for CAB39L Antibody (NBP1-74079)

View related products by pathway.

Blogs on CAB39L

There are no specific blogs for CAB39L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAB39L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAB39L
Uniprot