C4 binding protein A Antibody [mFluor Violet 500 SE]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: mFluor Violet 500 SE

C4 binding protein A Antibody [mFluor Violet 500 SE] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human C4 binding protein A (NP_000706.1).
  
  Sequence:
  QYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C4BPA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for C4 binding protein A Antibody [mFluor Violet 500 SE]

• C4b binding protein, alpha chain
• C4b-binding protein alpha chain
• C4BP
• complement component 4 binding protein, alpha chain
• complement component 4 binding protein, alpha
• complement component 4-binding protein, alpha
• Proline-rich protein
• PRP

Background

C4 binding protein A encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Two pseudogenes of this gene are also found in the cluster. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C4BPA