C3orf18 Antibody

Images

 
Western Blot: C3orf18 Antibody [NBP1-83405] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: C3orf18 Antibody [NBP1-83405] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: C3orf18 Antibody [NBP1-83405] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C3orf18 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KKKRLEKLRHQLMPMYNFDPTEEQDELEQELLEHGRDAASVQAATSVQAMQGKTTLPSQGPLQRPSRLVFTDVANAIHA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C3ORF18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C3orf18 Protein (NBP1-83405PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C3orf18 Antibody

  • chromosome 3 open reading frame 18
  • G20
  • hypothetical protein LOC51161
  • Protein G20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81019
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-92372
Species: Hu
Applications: IHC, IHC-P
H00006391-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-01693
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
PPS010
Species: Hu, Mu, Rt, Bv, Ch, Xp, Ze
Applications: WB
H00009374-T01
Species: Hu
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15548
Species: Hu
Applications: WB, IHC, IHC-P
MAB24601
Species: Hu
Applications: WB, IP, Neut
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
H00221823-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-93647
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for C3orf18 Antibody (NBP1-83405) (0)

There are no publications for C3orf18 Antibody (NBP1-83405).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C3orf18 Antibody (NBP1-83405) (0)

There are no reviews for C3orf18 Antibody (NBP1-83405). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C3orf18 Antibody (NBP1-83405) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C3orf18 Products

Bioinformatics Tool for C3orf18 Antibody (NBP1-83405)

Discover related pathways, diseases and genes to C3orf18 Antibody (NBP1-83405). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C3orf18 Antibody (NBP1-83405)

Discover more about diseases related to C3orf18 Antibody (NBP1-83405).

Blogs on C3orf18

There are no specific blogs for C3orf18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C3orf18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C3ORF18