HEMK1 Antibody

Images

 
Western Blot: HEMK1 Antibody [NBP1-81019] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: HEMK1 Antibody [NBP1-81019] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HEMK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VSNPPYVFHQDMEQLAPEIRSYEDPAALDGGEEGMDIITHILALAPRLLKDSGSIFLEVDPRHPELVSSWLQSRPDLYLNLVAVRRDFCG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HEMK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HEMK1 Protein (NBP1-81019PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HEMK1 Antibody

  • EC 2.1.1.-
  • FLJ22320
  • HEMK homolog 7kb
  • HemK methyltransferase family member 1
  • HEMK
  • m.HsaHemKP
  • MTQ1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009617-B01P
Species: Hu
Applications: WB
NBP1-31113
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005498-M01
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, KD, WB
NBP2-33600
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-43745
Species: Hu, Mu
Applications: Flow, IHC, IHC-Fr, WB
664-LI/CF
Species: Hu
Applications: BA
7559-ST
Species: Hu
Applications: BA
AF3194
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-37364
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-82072
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-86906
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-20849
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP3-03312
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00054456-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-89158
Species: Hu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP1-83405
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-80859
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for HEMK1 Antibody (NBP1-81019) (0)

There are no publications for HEMK1 Antibody (NBP1-81019).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HEMK1 Antibody (NBP1-81019) (0)

There are no reviews for HEMK1 Antibody (NBP1-81019). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HEMK1 Antibody (NBP1-81019) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HEMK1 Products

Bioinformatics Tool for HEMK1 Antibody (NBP1-81019)

Discover related pathways, diseases and genes to HEMK1 Antibody (NBP1-81019). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HEMK1 Antibody (NBP1-81019)

Discover more about diseases related to HEMK1 Antibody (NBP1-81019).

Blogs on HEMK1

There are no specific blogs for HEMK1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HEMK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HEMK1
Entrez